product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
SsTx Toxin
catalog :
STS-700
more info or order :
image
image 1 :

product information
cat :
STS-700
SKU :
STS-700_0.25 mg
Product Name :
SsTx Toxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
A0A2L0ART2
Accession Number :
https://www.uniprot.org/uniprotkb/A0A2L0ART2/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Scolopendra mutilans (Chinese red-headed centipede) (Scolopendra subspinipes mutilans)
Source :
Synthetic protein
Gene ID :
KCNQ1,KCNQ2,KCNQ4,KCNQ5,KCNA3
Product Page - Scientific background :
SsTx Toxin is a peptide toxin originally isolated from the Chinese red-headed centipede venoM SsTx structure consists of amino acids in position 12 and 13 which form a positively charged surface and two disulphide bridges. It is the first peptide toxin found to potently and selectively block KCNQ (KV7) channels, members of voltage-gated potassium (KV) channel family1 with IC50 values of 2.5, 2.8, 2.7, and 2.7 μM for KCNQ4, KCNQ1, KCNQ2, and KCNQ5 respectively1. The toxin also blocks KV1.3 channel with an IC50 value of ~5 μM3.SsTx blocks progressively less when the membrane potential becomes more depolarized, and high K+ concentrations increase the IC50 values, suggesting that the toxin binds to the outer pore domain of KCNQ channels1.KCNQ is a family of multifunctional K+ channels that are involved in a variety of physiological functions, including cardiac action potential repolarization, coronary circulation and reactive hyperemia, and cerebral neuron excitation. These channels are considered to be potential therapeutic targets for a variety of neuronal disorders1,2.
Supplier :
Alomone Labs
Target :
KCNQ1, KCNQ2, KCNQ4, KCNQ5, KV1.3 channels
Long Description :
A Blocker of KCNQ and KV1.3 Channels
Short Description :
A Blocker of KCNQ and KV1.3 Channels
MW :
6018 Da
Synonyms :
Potassium channel toxin SsTx, Ssm spooky toxin, Mu-scoloptoxin(15)-Ssm1a, Mu-SLPTX(15)-Ssm1a
Modifications :
Disulfide bonds between: Cys20-Cys46 and Cys24-Cys48
Molecular formula :
C270H413N69O79S4
Effective Concentration :
2 - 5 µM
Activity :
Blocks voltage-gated potassium channels KCNQ4, KCNQ1, KCNQ2 and KCNQ51 and KV1.32.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
EVIKKDTPYKKRKFPYKSECLKACATSFTGGDESRIQEG
KPGFFKCTCYFTTG-OH
KPGFFKCTCYFTTG-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments
