product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
SsdTx3
catalog :
STS-670
more info or order :
product information
cat :
STS-670
SKU :
STS-670_0.1 mg
Product Name :
SsdTx3
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P0DPV6
Accession Number :
https://www.uniprot.org/uniprotkb/P0DPV6/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Scolopendra dehaani (Thai centipede) (Scolopendra subspinipes dehaani)
Source :
Synthetic protein
Gene ID :
KCNJ11,ABCC8
Product Page - Scientific background :
SsdTx3 (kappa-scoloptoxin(15)-Ssd3a) is a toxin isolated from the venom of the centipede Scolopendra subspinipes dehaani, a species that inhabits Asia. SsdTx3 was found to be an inhibitor of hKATP channels by blocking the hKir6.2 pore co-expressed with hSUR1. Dose-Response curve of the hKATP channels inhibition revealed that SsdTx3 inhibits hKATP channels with a Kd values of 278nM1.SsdTx belongs to a family of five proteins, discovered so far from a multiple centipede species, that target hKATP channel by blocking the hKir6.2 pore. They have conserved features of four cysteine residues and a P-P segment that contains positively charged residues important for blocking the K+ pore1.ATP-sensitive K+ ion channels (KATP channels) can be found in many different tissues such as pancreatic β-cells, carried myocytes, skeletal muscle, smooth muscle and brain. KATP channels are responsible for linking between the cell metabolism and the membrane potential and therefore they are critical for the regulation of different cellular pathways2.
Supplier :
Alomone Labs
Target :
KATP inhibitor
Long Description :
A human KATP (Kir6.2/SUR1) potassium channel blocker
Short Description :
A human KATP (Kir6.2/SUR1) potassium channel blocker
MW :
6101 Da
Synonyms :
Kappa-scoloptoxin (15)-Ssd3a, Kappa-SLPTX(15)-Ssd3, Toxin SSD893, k- SLPTX(15)-Ssd3
Modifications :
Disulfide bonds between: The exact location of the disulfide bridges is currently unknown.
Molecular formula :
C273H422N74O77S4
Effective Concentration :
100 - 500 nM
Activity :
SsdTx3 inhibits hKATP channels with a Kd of
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
EVIRKEIPYKKRKFPYKSECRKACATAFTGGDESRIKDV
KPGFFKCSCYYSSG-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel