chemical

Spinoxin

STS-500

STS-500_0.1 mg

Spinoxin

Non Antibodies

Proteins

P84094

https://www.uniprot.org/uniprotkb/P84094/entry

Electrophysiology

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Heterometrus spinifer (Asia giant forest scorpion) (Malaysian black scorpion)

Synthetic peptide

KCNA2 ,KCNA3

Spinoxin (SPX, α-KTx6.13) is a 34-residue peptide toxin originally isolated from the scorpion Heterometrus spinifer venoM Spinoxin is a potent KV1.3 channel blocker displaying IC50 values of 63 nM It also has high affinity towards KV1.2 channels1,2.K+ ion channels play an important role in the modulation of Ca2+ signaling by controlling the membrane potential. These channels are considered to be very important targets in the diagnostics and therapy in several autoimmune disorders and cancers1.

Alomone Labs

KV1.2, KV1.3 channels

A Potent Blocker of KV1.2 and KV1.3 Channels

A Potent Blocker of KV1.2 and KV1.3 Channels

3700.4 Da

Potassium channel toxin alpha-KTx 6.13, SPX, α-KTx6.13

Disulfide bonds between: Cys3-Cys24, Cys9-Cys29, Cys13-Cys31 and Cys19-Cys34 Cys34 - C-terminal amidation

C147H236N48O46S9

2 - 100 nM

Spinoxin is a potent blocker of KV1.2 and KV1.3 channels1.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

752984-66-0

Lyophilized

Contact Alomone Labs for technical support and product customization

IRCSGSRDCYSPCMKQTGCPNAKCINKSCKCYGC-NH2

Yes

12352202

yes

no