product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Spinoxin
catalog :
STS-500
more info or order :
image
image 1 :

Alomone LabsMirtazapineblocks 5-HT3A receptors expressed in HEK 293T cells. - 5-HT3A receptor currents were elicited with 10 M 5-HT delivered every 3 minutes.Mirtazapine(#M-130) was applied 30 seconds before stimulation at 10 nM 100 nM and 1 M as indicated and inhibited the 5-HT induced current in a dose-dependent and reversible manner.
product information
cat :
STS-500
SKU :
STS-500_0.1 mg
Product Name :
Spinoxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P84094
Accession Number :
https://www.uniprot.org/uniprotkb/P84094/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Heterometrus spinifer (Asia giant forest scorpion) (Malaysian black scorpion)
Source :
Synthetic peptide
Gene ID :
KCNA2 ,KCNA3
Product Page - Scientific background :
Spinoxin (SPX, α-KTx6.13) is a 34-residue peptide toxin originally isolated from the scorpion Heterometrus spinifer venoM Spinoxin is a potent KV1.3 channel blocker displaying IC50 values of 63 nM It also has high affinity towards KV1.2 channels1,2.K+ ion channels play an important role in the modulation of Ca2+ signaling by controlling the membrane potential. These channels are considered to be very important targets in the diagnostics and therapy in several autoimmune disorders and cancers1.
Supplier :
Alomone Labs
Target :
KV1.2, KV1.3 channels
Long Description :
A Potent Blocker of KV1.2 and KV1.3 Channels
Short Description :
A Potent Blocker of KV1.2 and KV1.3 Channels
MW :
3700.4 Da
Synonyms :
Potassium channel toxin alpha-KTx 6.13, SPX, α-KTx6.13
Modifications :
Disulfide bonds between: Cys3-Cys24, Cys9-Cys29, Cys13-Cys31 and Cys19-Cys34 Cys34 - C-terminal amidation
Molecular formula :
C147H236N48O46S9
Effective Concentration :
2 - 100 nM
Activity :
Spinoxin is a potent blocker of KV1.2 and KV1.3 channels1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
752984-66-0
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
IRCSGSRDCYSPCMKQTGCPNAKCINKSCKCYGC-NH2
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments
