chemical

Slotoxin

STS-410

STS-410_0.1 mg

Slotoxin

Non Antibodies

Proteins

P0C182

https://www.uniprot.org/uniprotkb/P0C182/entry

Electrophysiology

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Centruroides noxius (Mexican scorpion)

Synthetic peptide

KCNMA1

Native Slotoxin was originally isolated from Centruroides noxius scorpion venoMNative Slotoxin blocks the Maxi K+ (BKCa or slo, KCNMA1, KCa1.1) channels.1Slotoxin blocks differentially channels formed by the α1 subunit alone and channels formed by the α1 combined with auxiliary β subunits. In Xenopus oocytes expressing hSlo (α1 alone), Kd was calculated to be 1.5 nM and the block is complete and reversible. With the additional co-expression of either the β1 or β4 subunits, the block become irreversible or causes the channel to be almost insensitive to the toxin, respectively.1

Alomone Labs

KCa1.1 K+ channels

A Blocker of KCa1.1 Channel

A Blocker of KCa1.1 Channel

4085.9 Da

K+ channel toxin α-KTx 1.11, SloTx

Disulfide bonds between: Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35

C177H275N47O50S7

10 - 100 nM

Slotoxin inhibits the Maxi K+ (BKCa or mSlo, KCNMA1, KCa1.1) channels1. Slotoxin differentially blocks channels formed by the α1 subunit alone and channels formed by the α1 combined with auxiliary β subunits.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

401470-29-9

Lyophilized

Contact Alomone Labs for technical support and product customization

TFIDVDCTVSKECWAPCKAAFGVDRGKCMGKKCKCYV-OH

Yes

12352202

yes

no