This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Alomone Labs
product type :
chemical
product name :
Slotoxin
catalog :
STS-410
product information
cat :
STS-410
SKU :
STS-410_0.1 mg
Product Name :
Slotoxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P0C182
Accession Number :
https://www.uniprot.org/uniprotkb/P0C182/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Centruroides noxius (Mexican scorpion)
Source :
Synthetic peptide
Gene ID :
KCNMA1
Product Page - Scientific background :
Native Slotoxin was originally isolated from Centruroides noxius scorpion venoMNative Slotoxin blocks the Maxi K+ (BKCa or slo, KCNMA1, KCa1.1) channels.1Slotoxin blocks differentially channels formed by the α1 subunit alone and channels formed by the α1 combined with auxiliary β subunits. In Xenopus oocytes expressing hSlo (α1 alone), Kd was calculated to be 1.5 nM and the block is complete and reversible. With the additional co-expression of either the β1 or β4 subunits, the block become irreversible or causes the channel to be almost insensitive to the toxin, respectively.1
Supplier :
Alomone Labs
Target :
KCa1.1 K+ channels
Long Description :
A Blocker of KCa1.1 Channel
Short Description :
A Blocker of KCa1.1 Channel
MW :
4085.9 Da
Synonyms :
K+ channel toxin α-KTx 1.11, SloTx
Modifications :
Disulfide bonds between: Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35
Molecular formula :
C177H275N47O50S7
Effective Concentration :
10 - 100 nM
Activity :
Slotoxin inhibits the Maxi K+ (BKCa or mSlo, KCNMA1, KCa1.1) channels1. Slotoxin differentially blocks channels formed by the α1 subunit alone and channels formed by the α1 combined with auxiliary β subunits.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
401470-29-9
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
TFIDVDCTVSKECWAPCKAAFGVDRGKCMGKKCKCYV-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel