product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
ShK (Stichodactyla Toxin)
catalog :
STS-400
more info or order :
image
image 1 :

Alomone Labs NS-6180 blocks KCa3.1 currents expressed in HEK 293T cells. - A. Time course of KCa3.1 current amplitude without and with 100 nMNS-6180(#N-230). Currents were elicited by application of voltage ramp from -120 mV to +60 mV (150 msec) delivered every 10 seconds holding potential of -80 mV. B. Superimposed example traces of current responses before and during perfusion of 100 nM NS-6180 as indicated.
image 2 :

Alomone Labs ShK (Stichodactyla Toxin) inhibits KV1.3 channels heterologously expressed inXenopusoocytes. - A. Time course of ShK (Stichodactyla Toxin)(#STS-400) action on KV1.3 currents. Current amplitude at +35 mV was plotted as a function of time. Membrane potential was held at -80 mV and cells were stimulated by a 100 ms voltage ramp to +40 mV. 0.1 nM for 240 sec (green) and 1 nM for 120 sec (red) Stichodactyla toxin were perfused as indicated by the bars.B. Superimposed examples of KV1.3 channel current in the absence (control) and presence of 0.1 nM (green) and 1 nM (red) Stichodactyla Toxin (taken from the experiment in A).
product information
cat :
STS-400
SKU :
STS-400_0.1 mg
Product Name :
ShK (Stichodactyla Toxin)
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P29187
Accession Number :
https://www.uniprot.org/uniprotkb/P29187/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Stichodactyla helianthus (Sun anemone) (Stoichactis helianthus)
Source :
Synthetic peptide
Gene ID :
KCNA1 ,KCNA2 ,KCNA3,KCNA4,KCNA6,KCNA7,KCNN4
Product Page - Scientific background :
ShK (Stichodactyla Toxin) is a peptidyl toxin originally isolated from the nematocyst of the sea anemone Stichodactyla helianthus.1ShK blocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold higher concentration than that required to inhibit KV1.3 channels. It has been shown to block KV current in DRG neurons, to displace radioactive Dendrotoxin from brain synaptosomes1 and inhibit I125-Charybdotoxin binding to Jurkat T lymphocytes with an IC50 of 32 pM2,4Evidence also suggests that native KV currents in the central nervous system, which are predominantly carried by KV1.2 channels, are highly sensitive to this toxin.5A fluorescently labeled synthetic ShK is used to recognize and to sort KV1.3 containing lymphocytes.4,6
Supplier :
Alomone Labs
Target :
Various KV K+ channels
Long Description :
A Blocker of KV Channels
Short Description :
A Blocker of KV Channels
MW :
4054.8 Da
Synonyms :
Kappa-stichotoxin-She3a, Potassium channel toxin ShK, Kappa-SHTX-She3a
Modifications :
Disulfide bonds between: Cys3-Cys35, Cys12-Cys28, and Cys17-Cys32
Molecular formula :
C169H274N54O48S7
Effective Concentration :
1 - 100 nM
Activity :
Stichodactyla Toxin blocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold higher concentration than that required to inhibit KV1.3 channels.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
172450-46-3
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments
