product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Stichodactyla Toxin-ATTO Fluor-590
catalog :
STS-400-AR
more info or order :
image
image 1 :
Alomone Labs STS-400-AR image 1
product information
cat :
STS-400-AR
SKU :
STS-400-AR_5 mcg
Product Name :
Stichodactyla Toxin-ATTO Fluor-590
Group Type :
Non Antibodies
Product Type :
Proteins
Applications :
Electrophysiology, Live cell imaging, Immunofluorescence, Direct flow cytometry
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day. Avoid exposure to light.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is lyophilized in 0.5 ml conical vial. The product is soluble in pure water to high-micromolar concentrations (5 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is lyophilized in 0.5 ml conical vial. The product is soluble in pure water to high-micromolar concentrations (5 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Stichodactyla helianthus (Sun anemone) (Stoichactis helianthus)
Source :
Modified synthetic peptide
Gene ID :
KCNA1 ,KCNA2 ,KCNA3,KCNA4,KCNA6,KCNA7,KCNN4
Product Page - Scientific background :
ShK (Stichodactyla Toxin) is a peptide toxin originally isolated from the nematocyst of the sea anemone Stichodactyla helianthus1.ShK blocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold higher concentration than that required to inhibit KV1.3 channels. It has been shown to block KV current in DRG neurons, to displace radioactive Dendrotoxin from brain synaptosomes1 and inhibit I125-Charybdotoxin binding to Jurkat T lymphocytes with an IC50 of 32 pM2,4.Evidence also suggests that native KV currents in the central nervous system, which are predominantly carried by KV1.2 channels, are highly sensitive to this toxin5.A fluorescently labeled synthetic ShK is used to recognize and to sort KV1.3 containing lymphocytes4,6.
Supplier :
Alomone Labs
Target :
KV1.1, KV1.3, KV1.4, KV1.6 channels
Long Description :
Fluorescent ShK Conjugate for Sensitive Detection of KV Channels
Short Description :
Fluorescent ShK Conjugate for Sensitive Detection of KV Channels
MW :
~4627 Da
Synonyms :
K+ channel toxin ShK, Toxin κ-stichotoxin-She3a, Kappa-stichotoxin-She3a, κ-SHTX-She3a
Modifications :
Disulfide bonds between: Cys3-Cys35, Cys12-Cys28, Cys17-Cys32 ATTO Fluor-590
Effective Concentration :
1 - 100 nM
Activity :
Stichodactyla Toxin blocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold higher concentration than that required to inhibit KV1.3 channels1-3.
Storage of solutions :
Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day. Avoid exposure to light.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel