product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Scyllatoxin
catalog :
STS-370
more info or order :
image
image 1 :

Alomone Labs Scyllatoxin inhibits rSK2 channels stably expressed in HEK293T cells. - rSK2 channel currents were measured using wholecell voltage clamp in the presence of Ca2+in the pipette solution. A voltage ramp from -120 mV to +60 mV was applied every 10 sec from a holding potential of -80 mV. A. Time course of current amplitude at 0 mV before (black) and during (green) application of 1 nMScyllatoxin(#STS-370). B. Representative current traces at control conditions (black) and following 140 s application of 1 nM Scyllatoxin (green) taken from the experiment in A.
image 2 :

Alomone Labs Scyllatoxin inhibits KCa2.2 channels heterologously expressed inXenopusoocytes. - Oocyte membrane potential was held at +5 mV (in a low Cl-solution) and currents were elicited by intraoocyte CaCl2injection. During the period marked by a green trace (30 seconds) 100 nM ofScyllatoxin(#STS-370) was applied by perfusion.
product information
cat :
STS-370
SKU :
STS-370_0.1 mg
Product Name :
Scyllatoxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P16341
Accession Number :
https://www.uniprot.org/uniprotkb/P16341/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Leiurus hebraeus (Hebrew deathstalker scorpion) (Leiurus quinquestriatus hebraeus)
Source :
Synthetic peptide
Gene ID :
KCNN1,KCNN2,KCNN3
Product Page - Scientific background :
Scyllatoxin is a 31 amino acid long toxin, originally isolated from the Leiurus quinquestriatus hebraeus scorpion venom, and is classified as α-KTx 5.1 scorpion toxin family, having three disulfide bridges1,2.Scyllatoxin was shown to compete with 125I-apamin binding in the brain3. Furthermore, Scyllatoxin appears to be selective for apamin-sensitive SK channels. Scyllatoxin inhibits apamin-sensitive SK channel activity in guinea-pig and rabbit hepatocytes4, SK currents in human lymphoblastoma cells5,6, and epinephrine-induced relaxation of visceral smooth muscle7.Scyllatoxin also inhibits the apamin-sensitive after hyperpolarization that follows action potentials in skeletal muscle7 and neurons8. The SK channel-mediated after hyperpolarising current (IAHP) of dorsal vagal neurons, presuming Kca2.3 (SK3), were blocked by Scyllatoxin (20-30 nM)9. HEK 293 cell currents stably expressing hKca2.1 (hSK1) and Kca2.2 (hSK2) were blocked by Scyllatoxin with an IC50 of 80 nM and 287 pM, respectively10.
Supplier :
Alomone Labs
Target :
KCa2 K+ channels
Long Description :
A Potent Blocker of KCa2 (SK) K+ Channels
Short Description :
A Potent Blocker of KCa2 (SK) K+ Channels
MW :
3423 Da
Synonyms :
K+ channel toxin α-KTx 5.1, Leiurotoxin I, LeTx I, ScyTx
Modifications :
Disulfide bonds between: Cys3-Cys21, Cys8-Cys26, and Cys12-Cys28 His31 - C terminal amidation
Molecular formula :
C142H237N45O39S7
Effective Concentration :
20 - 200 nM
Activity :
Scyllatoxin inhibits small conductance Ca2+-activated K+ channels (SK)1-3.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
142948-19-4
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH-NH2
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments