chemical

Stromatoxin-1

STS-350

STS-350_0.1 mg

Stromatoxin-1

Non Antibodies

Proteins

P60991

https://www.uniprot.org/uniprotkb/P60991/entry

Electrophysiology

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Stromatopelma calceatum (Featherleg baboon tarantula) (Scodra calceata)

Synthetic peptide

KCNB1,KCNB2 ,KCND2,KCNS3

Stromatoxin-1 is a 34 amino acid peptidyl toxin originally isolated from Stromatopelma calceatum tarantula1. Structurally, Stromatoxin-1 belongs to the scaffold of structural inhibitor cysteine knot peptide family, which were shown to function as gating modifiers2.Stromatoxin-1 selectively inhibits KV2.1, KV2.1/9.3, and KV4.2 channel currents (IC50 of 12.7 nM, 7.2 nM and 1.2 nM respectively), and is the first high-affinity voltage gating modifier inhibitor of the KV2.2 channel subtype (IC50, 21.4 nM) to be discovered1.

Alomone Labs

Various KV channels

A Potent Blocker of KV2.1, KV2.2, KV4.2 and KV9.3 Channels

A Potent Blocker of KV2.1, KV2.2, KV4.2 and KV9.3 Channels

3791.4 Da

κ-Theraphotoxin-Sc1a, κ-TRTX-Sc1a, ScTx1

Disulfide bonds between: Cys2-Cys16, Cys9-Cys21 and Cys15-Cys28 Ile34 - C-terminal amidation

C156H237N49O48S7

1.2 - 670 nM

Stromatoxin-1 is a potent inhibitor of voltage-gated K+ channels. It inhibits delayed KV2.1, KV2.1/9.3, KV2.2, and transient KV4.2 channels1,2.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

741738-59-0

Lyophilized

Contact Alomone Labs for technical support and product customization

DCTRMFGACRRDSDCCPHLGCKPTSKYCAWDGTI-NH2

Yes

12352202

yes

no

Electrophysiology