product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Phlotoxin 1
catalog :
STP-800
more info or order :
product information
cat :
STP-800
SKU :
STP-800_0.1 mg
Product Name :
Phlotoxin 1
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P0DM14
Accession Number :
https://www.uniprot.org/uniprotkb/P0DM14/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Phlogiellus sp. (Tarantula)
Source :
Synthetic peptide
Gene ID :
SCN1A,SCN2A,SCN3A,SCN4A,SCN5A,SCN8A,SCN9A
Product Page - Scientific background :
Phlotoxin 1 (PhlTx1) is a voltage-gated Na+ channel (NaV) blocker, originally isolated from the venom of a Phlogiellus genus spider endemic to Papua New Guinea.Phlotoxin 1, characterized by a 34-amino acids sequence with 3 disulfide bridges and structure around the inhibitory cysteine-knot (ICK) architectural motif, was shown to belong to the spider toxin NaSpTx family 11,2.Nav1.7 was identified as the most sensitive ion channel and main target for Phlotoxin 1 inhibition3. NaV1.7 channel plays an important role in human pain signaling pathway and it is an important therapeutic target for treatment of chronic pain. Hence, Phlotoxin 1 is an important candidate for the study of pain, pain treatment, and development of analgesics. It is also an interesting toxin in order to decipher the involvement of Nav1.7 in cellular excitability and pain3,4.
Supplier :
Alomone Labs
Target :
NaV channels
Long Description :
Selective Blocker of NaV1.7
Short Description :
Selective Blocker of NaV1.7
MW :
4057.7 Da
Synonyms :
Mu-theraphotoxin-Pspp1, Mu-TRTX-Pspp1, PhlTx1
Modifications :
Disulfide bonds between: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29 Phe34 - C-terminal amidation
Molecular formula :
C183H255N47O47S6
Effective Concentration :
0.2 - 1 µM
Activity :
A potent blocker of Nav1.7 channel1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
ACLGQWDSCDPKASKCCPNYACEWKYPWCRYKLF-NH2
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel