product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Phrixotoxin-3
catalog :
STP-720
more info or order :
citations: 4
| Reference |
|---|
image
image 1 :
Alomone Labs Phrixotoxin-3 blocks NaV1.6 channels expressed in Xenopus oocytes. - A. NaV1.6 currents were elicited by a 100 ms voltage step from a holding potential of -100 mV to -10 mV every 10 sec.Phrixotoxin-3(#STP-720) applied at 100 nM and 500 nM as indicated (bars) inhibits Nav1.6 currents in a concentration dependent manner. B. Superimposed NaV1.6 current traces (taken from the experiment in A) upon application of control or of 100 nM and 500 nM Phrixotoxin-3 (as indicated).
image 2 :
Western blot analysis of mouse kidney membranes: - 1.Anti-Prostaglandin E Receptor EP3 (PTGER3) Antibody(#APR-065) (1:200).2. Anti-Prostaglandin E Receptor EP3 (PTGER3) Antibody preincubated with the negative control antigen.
product information
cat :
STP-720
SKU :
STP-720_0.1 mg
Product Name :
Phrixotoxin-3
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P84510
Accession Number :
https://www.uniprot.org/uniprotkb/P84510/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Paraphysa scrofa (Chilean copper tarantula) (Phrixotrichus auratus)
Source :
Synthetic peptide
Gene ID :
SCN1A, SCN2A,SCN4A,SCN5A,SCN8A,SCN9A,SCN10A
Product Page - Scientific background :
Phrixotoxin-3 is a peptidyl toxin originally isolated from the venom of Phrixotrichus auratus tarantula. This toxin is a highly specific and potent blocker of voltage-gated Na+ channels especially the neuronal channel NaV1.2 with properties similar to those of typical gating-modifier toxins. It causes a depolarizing shift in the gating kinetics by blocking the inward component of the sodium current1.Injection of Phrixotoxin-3 to mice causes neurotoxicity symptoms that are expressed by general ataxia, lack of response to stimuli, and semiparalysis1.
Supplier :
Alomone Labs
Target :
NaV1.2, NaV1.6 channels
Long Description :
A Potent Blocker of NaV1.2 and NaV1.6 Channels
Short Description :
A Potent Blocker of NaV1.2 and NaV1.6 Channels
MW :
4058.8 Da
Synonyms :
PaurTx3, β-TRTX-Ps1a, β-theraphotoxin-Ps1a, Phrixotoxin 3
Modifications :
Disulfide bonds between: Cys2-Cys17, Cys9-Cys23, and Cys16-Cys30 Ile34 - C-terminal amidation
Molecular formula :
C176H270N52O47S6
Effective Concentration :
0.5 - 300 nM
Activity :
Phrixotoxin-3 specifically and reversibly blocks NaV1.21.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥99% (HPLC)
CAS No :
880886-00-0
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI-NH2
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments