Phrixotoxin-2 | Alomone Labs STP-710 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

Phrixotoxin-2

catalog :

STP-710

more info or order :

Alomone Labs product webpage

citations: 4

Reference
Chiu W, Kovacheva L, Musgrove R, Arien Zakay H, Koprich J, Brotchie J, et al. α-Synuclein-induced Kv4 channelopathy in mouse vagal motoneurons drives nonmotor parkinsonian symptoms. Sci Adv. 2021;7: pubmed publisher
Biró A, Brémaud A, Falck J, Ruiz A. A-type K+ channels impede supralinear summation of clustered glutamatergic inputs in layer 3 neocortical pyramidal neurons. Neuropharmacology. 2018;140:86-99 pubmed publisher
Groschner L, Chan Wah Hak L, Bogacz R, Dasgupta S, Miesenbock G. Dendritic Integration of Sensory Evidence in Perceptual Decision-Making. Cell. 2018;173:894-905.e13 pubmed publisher
Subramaniam M, Althof D, Gispert S, Schwenk J, Auburger G, Kulik A, et al. Mutant Î±-synuclein enhances firing frequencies in dopamine substantia nigra neurons by oxidative impairment of A-type potassium channels. J Neurosci. 2014;34:13586-99 pubmed publisher

image

image 1 :

Western blot analysis of rat kidney (lanes 1 and 3) and pancreas (lanes 2 and 4)membranes: - 12.Anti-Prostaglandin E Receptor EP3 (PTGER3) Antibody(#APR-065) (1:200).34. Anti-Prostaglandin E Receptor EP3 (PTGER3) Antibody preincubated with the negative control antigen.

image 2 :

Alomone Labs Phrixotoxin-2 inhibits KV4.2 channel expressed in Xenopus oocytes. - A. Time course ofPhrixotoxin-2(#STP-710) action on KV4.2 peak current amplitude. Peak current amplitudes were plotted as a function of time. Membrane potential was held at -90 mV and oocytes were stimulated by a 100 ms voltage step to 0 mV. 200 nM Phrixotoxin-2 was perfused as indicated by the bar (green) for 160 sec. B. Superimposed examples of KV4.2 channel maximum peak current in the absence (control) and presence (green) of 200 nM Phrixotoxin-2 (taken from the experiment in A).

product information

cat :

STP-710

SKU :

STP-710_0.1 mg

Product Name :

Phrixotoxin-2

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P61231

Accession Number :

https://www.uniprot.org/uniprotkb/P61231/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Paraphysa scrofa (Chilean copper tarantula) (Phrixotrichus auratus)

Source :

Synthetic peptide

Gene ID :

KCND2,KCND3

Product Page - Scientific background :

Phrixotoxin-2 is a natural peptide isolated from the Phrixotrichus auratus Tarantula venoM It blocks specifically and reversibly KV4.2 and KV4.3 channels.1 These channels are probably the molecular counterparts of the A-type current (Ito1) in the heart. Cloned KV4.2 and KV4.3 channels heterologously expressed in COS cell were blocked with IC50 of 34 and 71 nM of Phrixotoxin-2 respectively1.

Supplier :

Alomone Labs

Target :

KV4 channels

Long Description :

A Potent Blocker of KV4 Channels

Short Description :

A Potent Blocker of KV4 Channels

MW :

3921.7 Da

Synonyms :

κ-theraphotoxin-Ps1b, κ-TRTX-Ps1b, PaTX2, Kappa-theraphotoxin-Ps1b

Modifications :

Disulfide bonds between: Cys2-Cys16, Cys9-Cys21, and Cys15-Cys25 Met31 - C-terminal amidation

Molecular formula :

C169H259N49O43S8

Effective Concentration :

100 - 500 nM

Activity :

Phrixotoxin-2 specifically and reversibly blocks KV4.21.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥99% (HPLC)

CAS No :

221889-63-0

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

YCQKWMWTCDEERKCCEGLVCRLWCKRIINM-NH2

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage