product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Phrixotoxin-1
catalog :
STP-700
more info or order :
citations: 3
Reference
Ji X, Martin G. BK channels mediate dopamine inhibition of firing in a subpopulation of core nucleus accumbens medium spiny neurons. Brain Res. 2014;1588:1-16 pubmed publisher
Sethi J, Sanchez Alavez M, Tabarean I. Kv4.2 mediates histamine modulation of preoptic neuron activity and body temperature. PLoS ONE. 2011;6:e29134 pubmed publisher
Schaarschmidt G, Wegner F, Schwarz S, Schmidt H, Schwarz J. Characterization of voltage-gated potassium channels in human neural progenitor cells. PLoS ONE. 2009;4:e6168 pubmed publisher
image
image 1 :
Alomone Labs STP-700 image 1
Peptide (C)RAPHWYASHMKTR corresponding to amino acid residues 137-149 of mouse prostanoid EP3 receptor (AccessionP34980). 2ndintracellular loop.
image 2 :
Alomone Labs STP-700 image 2
Alomone Labs Phrixotoxin-1 inhibits KV4.2 channels expressed in Xenopus oocytes. - A. Time course ofPhrixotoxin-1(#STP-700) action on KV4.2 current amplitude recorded at 10 mV. Current amplitudes were plotted as a function of time. Membrane potential was held at -100 mV and oocytes were stimulated by a 100 ms voltage ramp to +20 mV. 50 nM Phrixotoxin-1 was perfused as indicated by the bar (green) for 220 sec. B. Superimposed examples of KV4.2 channel current in the absence (control) and presence (green) of 50 nM Phrixotoxin-1 (taken from the experiment in A).
product information
cat :
STP-700
SKU :
STP-700_0.1 mg
Product Name :
Phrixotoxin-1
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P61230
Accession Number :
https://www.uniprot.org/uniprotkb/P61230/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Paraphysa scrofa (Chilean copper tarantula) (Phrixotrichus auratus)
Source :
Synthetic peptide
Gene ID :
KCND2,KCND3,SCN9A
Product Page - Scientific background :
Phrixotoxin-1 (PaTx1) is a 29 amino acid peptidyl toxin isolated from the venom of the theraphosid Phrixotrichus auratus, which potently blocks A-type K+ currents.PaTx1 specifically blocks KV4.3 and KV4.2 currents with a 5 nM < IC50 < 70 nM, by modifying the gating properties of these channels.1As with other spider toxins, PaTx1 presents an active molecular surface, including a hydrophobic patch surrounded by charged residues, which are important for their binding on KV channels. Electrophysiological studies show that the PaTx1 blocks KV4 channels via a mechanism similar to that of hanatoxins on KV2 channels, as they bind and stabilize the preferentially closed state of the channel, in a voltage-dependent manner.2PaTx1 is a crucial tool for understanding the contribution of KV4.3 and KV4.2 in cardiac electrogenesis. Treatment of mice with PaTx1 results in numerous transient cardiac adverse reactions including the occurrence of premature ventricular beats, ventricular tachycardia, different degrees of atrioventricular (AV) blockage and prolongation of the QT interval.1
Supplier :
Alomone Labs
Target :
KV4.2, KV4.3 channels
Long Description :
A Potent Blocker of KV4.2 and KV4.3 Channels
Short Description :
A Potent Blocker of KV4.2 and KV4.3 Channels
MW :
3548.4 Da
Synonyms :
κ-theraphotoxin-Ps1a, κ-TRTX-Ps1a, PaTX1
Modifications :
Disulfide bonds between: Cys2-Cys16, Cys9-Cys21, and Cys15-Cys25 Ile29 - C-terminal amidation
Molecular formula :
C156H240N44O37S7.
Effective Concentration :
10 - 100 nM
Activity :
Phrixotoxin-1 specifically and reversibly blocks KV4.2 and KV4.3 channels1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥99% (HPLC)
CAS No :
221872-97-5
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
YCQKWMWTCDSARKCCEGLVCRLWCKKII-NH2
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel