Pandinotoxin Kα | Alomone Labs STP-500 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

Pandinotoxin Kα

catalog :

STP-500

more info or order :

Alomone Labs product webpage

image

image 1 :

image 2 :

Alomone Labs Pandinotoxin K?inhibits KV1.2 channels heterologously expressed inXenopusoocytes. - A. Time course ofPandinotoxin K?(#STP-500) action on KV1.2 currents. KV1.2 currents were elicited by 100 ms voltage ramp from the holding potential of -80 mV to +10 mV. 10 nM and 100 nM Pandinotoxin K? were perfused as indicated by the bars at -10 mV. B. Superimposed examples of KV1.2 channel current in the absence (control) and presence of 10 nM or 100 nM Pandinotoxin K? (taken from the experiment in A).

product information

cat :

STP-500

SKU :

STP-500_0.1 mg

Product Name :

Pandinotoxin Kα

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P55927

Accession Number :

https://www.uniprot.org/uniprotkb/P55927/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Pandinus imperator (Emperor scorpion)

Source :

Synthetic peptide

Gene ID :

KCNA2,KCNA4,KCND1,KCND2,KCND3

Product Page - Scientific background :

Scorpion venoms are a rich source of ion channel modulators. The scorpion toxins have been useful molecules in probing the K+ channel structures and functions1.Pandinotoxin Kα (PiTx-Kα) is a 35 amino acid peptidyl toxin isolated from the Pandinus imperator (Emperor scorpion) venoM It is a highly potent and selective blocker of voltage-activated K+ channels. PiTx-Kα preferentially blocks rapidly inactivating (A-type) K+ channels2. In general, channel inhibitors can be pore blockers or gating modifiers. Pore blockers bind to the channel in 1:1 stoichiometry and plug the pore of the channel impeding the flow of the ionic current. These toxins are small proteins that block the passage of K+ ions by binding at the pore entryway on the extracellular side of the channel, thereby inhibiting the ion flux3. The interactions of toxins with K+ channels are among the strongest and most specific known in protein-protein complexes4.

Supplier :

Alomone Labs

Target :

A-type and Shaker-related K+ channels

Long Description :

A Blocker of A-Type and Shaker-Related Voltage-Gated K+ Channels

Short Description :

A Blocker of A-Type and Shaker-Related Voltage-Gated K+ Channels

MW :

4033.8 Da

Synonyms :

Potassium channel toxin α-KTx 7.1, Pandinotoxin-α, Potassium channel-blocking toxin 2, Pi-2, Pi2, Toxin PiTX-K-α, PiTX-Kα

Modifications :

Disulfide bonds between: Cys4-Cys25, Cys10-Cys30, Cys14-Cys32

Molecular formula :

C169H267N53O48S7

Effective Concentration :

10 - 200 nM

Activity :

Pandinotoxin Kα is an A-type and Shaker-related K+ channel blocker1-4.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

CAS No :

185529-64-0

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

TISCTNPKQCYPHCKKETGYPNAKCMNRKCKCFGR-OH

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage