ProTx-I | Alomone Labs STP-400 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

ProTx-I

catalog :

STP-400

more info or order :

Alomone Labs product webpage

image

image 1 :

Alomone LabsProTx-I inhibits NaV1.5 currents in stably transfected HEK293 cells. - A. Time course ofProTx-I(#STP-400) action. Current amplitudes were plotted as a function of time. Holding potential was -100 mV and currents were stimulated every 10 seconds by a voltage ramp of 50 msec from holding potential to +60 mV. 50 nM ProTx-I was perfused in the period marked by the horizontal bar (green). B. Superimposed traces of NaV1.5 currents before and during 3 min application of 50 nM ProTx-I.

product information

cat :

STP-400

SKU :

STP-400_0.1 mg

Product Name :

ProTx-I

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P83480

Accession Number :

https://www.uniprot.org/uniprotkb/P83480/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Thrixopelma pruriens (Peruvian green velvet tarantula)

Source :

Synthetic peptide

Gene ID :

CACNA1G,KCNB1,SCN10A,SCN2A,SCN5A,SCN8A,SCN9A,TRPA1

Product Page - Scientific background :

Native ProTx-I has been isolated from the venom of the tarantula Thrixopelma pruriens. It was purified on the basis of its ability to reversibly inhibit the tetrodotoxin (TTX)-resistant Na channel NaV1.8. ProTx-I was also found to be an inhibitor of NaV1.5, NaV1.7 and NaV1.3 with IC50 values below 100 nM Furthermore, ProTx-I shifts the voltage dependence activity of CaV3.1 (α1G) (IC50 ~50 nM) without affecting the voltage dependence of inactivation1,2. ProTx-I also blocks TRPA1 channel with an IC50 of 0.39 µM3.Structurally, ProTx-I is shown to belong to the inhibitory cystine knot (ICK) family of peptidyl toxins interacting with voltage-gated ion channels.

Supplier :

Alomone Labs

Target :

NaV, CaV3.1, KV2.1, TRPA1 channels

Long Description :

A Blocker of NaV, CaV3.1, KV2.1 and TRPA1 Channels

Short Description :

A Blocker of NaV, CaV3.1, KV2.1 and TRPA1 Channels

MW :

3987.6 Da

Synonyms :

β-theraphotoxin-Tp1a, Beta-theraphotoxin-Tp1a, Protoxin-I, ProTx-1, Protoxin-1, ProTx I

Modifications :

Disulfide bonds between: Cys2-Cys16, Cys9-Cys21, Cys15-Cys28

Molecular formula :

C171H245N53O47S6

Effective Concentration :

10 - 100 nM

Activity :

ProTx-I inhibits voltage-gated Ca2+ (CaV3.1), K+ (KV2.1), and all Na+ channels tested (NaV1.2, NaV1.5, NaV1.7 and NaV1.8). The toxin shifts the voltage-dependence of channel activation to more positive potentials.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

CAS No :

484598-35-8

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

ECRYWLGGCSAGQTCCKHLVCSRRHGWCVWDGTFS-OH

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage