chemical

Phlo1a

STP-350

STP-350_0.1 mg

Phlo1a

Non Antibodies

Proteins

P0DL57

https://www.uniprot.org/uniprotkb/P0DL57/entry

Electrophysiology

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Phlogius sp. (Tarantula spider)

Synthetic peptide

SCN9A

Phlo1a is a voltage-gated NaV1.7 channel blocker. It is a peptide toxin originally isolated from the venom of the Australian Phlogius sp. Tarantula. It inhibits the channel's activation through interaction with one or more voltage-sensor domains. Phlo1a inhibits human NaV1.7 channels in a concentration-dependent manner with an IC50 value of 459 nM1.Phlo1a is 35-residue peptide that belongs to the NaSpTx family and is considered to be a valuable research tool and a lead molecule for the development of ion channel therapeutics. To date, twelve families of NaSpTx have been recognized. Phlo1a belongs to the NaSpTx2 family and contains three disulfide bonds. The majority of tarantula-venom peptides share a highly stable inhibitor cystine knot (ICK) fold that provides resistance to chemical and thermal degradation1.There are nine mammalian subtypes of voltage-gated sodium (NaV) channels: NaV1.1-NaV1.9. They are transmembrane proteins responsible for propagating action potentials in excitable cells, most notably nerves and muscle. These channels are considered to be important therapeutic targets for a wide variety of pathophysiological conditions such as chronic pain, cardiac arrhythmia, and epilepsy1,2.

Alomone Labs

NaV1.7 channels

A Blocker of NaV1.7 Channels

A Blocker of NaV1.7 Channels

4106.8 Da

Mu-theraphotoxin-Phlo1a, Mu-TRTX-Phlo1a

Disulfide bonds between: Cys2-Cys16, Cys9-Cys21, and Cys15-Cys29 (by homology) Ile35 - C-terminal amidation

C178H262N52O49S6

100 nM - 1 µM

PhIo1a is a blocker of NaV1.7 channel1.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

Lyophilized

Contact Alomone Labs for technical support and product customization

ACRELLGGCSKDSDCCAHLECRKKWPYHCVWDWTI-NH2

Yes

12352202

yes

no