chemical

Psalmotoxin-1

STP-200

STP-200_0.1 mg

Psalmotoxin-1

Non Antibodies

Proteins

P60514

https://www.uniprot.org/uniprotkb/P60514/entry

Electrophysiology

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Psalmopoeus cambridgei (Trinidad chevron tarantula)

Synthetic peptide

ASIC1,ASIC1a,ASIC1b

Native Psalmotoxin1 (PcTx1) is a 40-amino acid toxin originally isolated from the venom of the South American tarantula Psalmopoeus cambridgei.1PcTX1 is characterized by the unusual quadruplet Lys25-Arg26-Arg27-Arg28, which probably forms a strongly positive "patch" at the surface of the toxin molecule, constituting an area that is a strong candidate for channel binding site recognition. The molecular scaffold of PcTX1 is likely to be similar to that previously described for both cone snail and spider toxins5,6 and comprises a triple-stranded antiparallel β-sheet structure reticulated by three disulfide bridges.1PcTx1 potently (IC50 = 0.9 nM) and specifically blocks a particular subclass of H+-gated cation channels, the Acid-sensing ion channels 1a (ASIC1a) and is able to discriminate between the two splice variant subtypes and not block the ASIC1b channel (which differs only in its N-terminal sequence). Moreover, PcTX1 loses its capacity to block ASIC1a as soon as this subunit is associated with another member of the family (ASIC2a or ASIC3).1The ASICs are abundant in the brain and spinal cord neurons and are implicated in pain sensation, ischemic stroke mechanosensation, learning and memory.2,3 In acute and neuropathic pain models, specific blockage of ASIC1a with PcTx1 results in analgesic effects working upstream of the opiate receptors.4Using an iodinated form of the toxin, the binding for the PcTX1 site identifies at the cysteine-rich domains I and II (CRDI and CRDII) of the extracellular loop of ASIC1a. A disulphide bridge between domains 1 and 4 of the channel supports a close relationship between the CRDI4-CRDII domain, where PcTx1 acts, and the post-M1 region, the binding site for the proton.7

Alomone Labs

ASIC1a channels

A Potent Blocker of ASIC1a Channels

A Potent Blocker of ASIC1a Channels

4689.5 Da

PcTx-1, PcTx1, π-Theraphotoxin-Pc1a, Psalmotoxin 1

Disulfide bonds between: Cys3-Cys18, Cys10-Cys23 and Cys17-Cys33

C200H312N62O57S6

1 - 10 nM

Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥99% (HPLC)

316808-68-1

Lyophilized

Contact Alomone Labs for technical support and product customization

EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPK
T-OH

Yes

12352202

yes

no

Electrophysiology