ProTx-II | Alomone Labs STP-100 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

ProTx-II

catalog :

STP-100

more info or order :

Alomone Labs product webpage

citations: 1

Reference
Das S, Gilchrist J, Bosmans F, Van Petegem F. Binary architecture of the Nav1.2-Î²2 signaling complex. elife. 2016;5: pubmed publisher

image

image 1 :

Alomone Labs ProTx-II blocks human NaV1.5 current stably expressed in HEK-293 cells. - hNaV1.5 currents were elicited by 50 ms voltage ramp from the holding potential of -100 mV to +60 mV applied every 10 sec using whole-cell voltage clamp technique. Left: Superimposed traces of hNaV1.5 currents measured under control conditions and after 100 sec perfusion with 50 100 and 200 nMProTx-II(#STP-100) as indicated. Inset: Time course of hNaV1.5 current amplitude change as a result of 102550 100 and 200 nM ProTx-II application as indicated by the horizontal bars. Right: ProTx-II dose response of hNaV1.5 currents (n = 3).

image 2 :

Alomone LabsIfenprodil (+)-tartrate salt (hemitartrate salt)inhibits NMDA (NR1+NR2A) channels expressed inXenopusoocytes. - A. Time course of NMDA currents elicited with 100 M glutamate and 100 M Glycine every 50s while membrane potential was held at -80 mV. 100 MIfenprodil (+)-tartrate salt (hemitartrate salt)(#I-105) applied for 3 min as indicated reversibly inhibited current amplitude. B. superimposed current traces taken from the experiment described in A.

product information

cat :

STP-100

SKU :

STP-100_0.1 mg

Product Name :

ProTx-II

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P83476

Accession Number :

https://www.uniprot.org/uniprotkb/P83476/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Thrixopelma pruriens (Peruvian green velvet tarantula)

Source :

Synthetic peptide

Gene ID :

CACNA1C,CACNA1H,SCN2A,SCN3A,SCN4A,SCN5A,SCN8A,SCN9A,SCN10A

Product Page - Scientific background :

ProTx-II is a peptidyl toxin originally produced in Thrixopelma pruriens, the Peruvian green velvet tarantula. It was identified as a voltage-gated Na+ channel (NaV) blocker which inhibits both tetrodotoxin-sensitive and tetrodotoxin-resistant channels1.Binding of ProTx-II to an extracellular domain of NaV channel, probably to a hydrophobic site3, inhibits current by shifting the channel activation to more positive potentials1-2.ProTx-II Inhibits NaV1.2, NaV1.3, NaV1.5, NaV1.6, NaV1.7, and NaV1.8. It is a significantly more potent inhibitor against NaV1.7 than the other NaV channel subtypes1.ProTx-II was also found as an effective modulator which shifts the voltage dependence activity of T-type Ca2+ channel1.

Supplier :

Alomone Labs

Target :

NaV channels and T-type Ca2+ channels

Long Description :

A Blocker of NaV1.7 and NaV1.5 Channels and Some T-Type Ca2+ Channels

Short Description :

A Blocker of NaV1.7 and NaV1.5 Channels and Some T-Type Ca2+ Channels

MW :

3826.6 Da

Synonyms :

β/ω-Theraphotoxin-Tp2a, Protoxin-2, PT-II, ProTx2, Protoxin2, ProTx II

Modifications :

Disulfide bonds between: Cys2-Cys16, Cys9-Cys21, and Cys15-Cys25

Molecular formula :

C168H250N46O41S8

Effective Concentration :

10 - 500 nM

Activity :

ProTx-II inhibits NaV channels1. ProTx-II could also modulate T-type Ca2+ channels at higher concentrations2.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

CAS No :

484598-36-9

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

YCQKWMWTCDSERKCCEGMVCRLWCKKKLW-OH

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage