product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Pe1b Toxin
catalog :
STP-050
more info or order :
product information
cat :
STP-050
SKU :
STP-050_0.1 mg
Product Name :
Pe1b Toxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P0DQN2
Accession Number :
https://www.uniprot.org/uniprotkb/P0DQN2/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Phormingochilus everetti (Malaysian purple earth tiger tarantula)
Source :
Synthetic peptide
Gene ID :
SCN2A,SCN8A,SCN9A
Product Page - Scientific background :
β/μ-theraphotoxin-Pe1b (Pe1b) is a 34 amino acid peptidyl toxin isolated from the venom of the arboreal tarantula Phormingochilus everetti1. Pe1b is a voltage-gated sodium (Nav) channel inhibitor, and it has the greatest inhibitory activity against Nav1.7. Pe1b contains three disulfide bonds that form an inhibitory cysteine-knot (ICK) architectural motif. Its ICK motif belonging to the Nav-targeting spider toxin (NaSpTx) family 2, which contains the most members amongst the 12 sodium channel toxin families (NaSpTx1- NaSpTx12)1,2.Pe1b is highly similar to Protoxin-1 (ProTx-I), which is also an inhibitor of Nav1.7. The C-terminus of both toxins interact with Nav1.71.Nav channels are involved in a wide array of physiological processes. In particular, Nav1.7 plays a critical role in the generation and conduction of action potentials. It is also active in pain sensing nerves. Thus, Pe1b may be an important tool for the study of pain, pain treatment, and the development of analgesics.
Supplier :
Alomone Labs
Target :
Voltage-gated Na+ channels
Long Description :
Selective potent blocker of Nav1.7 channels
Short Description :
Selective potent blocker of Nav1.7 channels
MW :
3975.5 Da
Synonyms :
Beta/mu-theraphotoxin-Pe1b, Beta/mu-TRTX-Pe1b, β/μ-theraphotoxin-Pe1b
Modifications :
Disulfide bonds between: Cys2-Cys16, Cys9-Cys21, Cys15-Cys28
Molecular formula :
C175H237N47O49S6
Effective Concentration :
50 - 500 nM
Activity :
Blocks several voltage-gated sodium channels with most potent activity on Nav1.71.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
ECRYWLGGCSKTGDCCEHLSCSPKWHWCVWDGTF-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel