chemical

Pe1b Toxin

STP-050

STP-050_0.1 mg

Pe1b Toxin

Non Antibodies

Proteins

P0DQN2

https://www.uniprot.org/uniprotkb/P0DQN2/entry

Electrophysiology

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Phormingochilus everetti (Malaysian purple earth tiger tarantula)

Synthetic peptide

SCN2A,SCN8A,SCN9A

β/μ-theraphotoxin-Pe1b (Pe1b) is a 34 amino acid peptidyl toxin isolated from the venom of the arboreal tarantula Phormingochilus everetti1. Pe1b is a voltage-gated sodium (Nav) channel inhibitor, and it has the greatest inhibitory activity against Nav1.7. Pe1b contains three disulfide bonds that form an inhibitory cysteine-knot (ICK) architectural motif. Its ICK motif belonging to the Nav-targeting spider toxin (NaSpTx) family 2, which contains the most members amongst the 12 sodium channel toxin families (NaSpTx1- NaSpTx12)1,2.Pe1b is highly similar to Protoxin-1 (ProTx-I), which is also an inhibitor of Nav1.7. The C-terminus of both toxins interact with Nav1.71.Nav channels are involved in a wide array of physiological processes. In particular, Nav1.7 plays a critical role in the generation and conduction of action potentials. It is also active in pain sensing nerves. Thus, Pe1b may be an important tool for the study of pain, pain treatment, and the development of analgesics.

Alomone Labs

Voltage-gated Na+ channels

Selective potent blocker of Nav1.7 channels

Selective potent blocker of Nav1.7 channels

3975.5 Da

Beta/mu-theraphotoxin-Pe1b, Beta/mu-TRTX-Pe1b, β/μ-theraphotoxin-Pe1b

Disulfide bonds between: Cys2-Cys16, Cys9-Cys21, Cys15-Cys28

C175H237N47O49S6

50 - 500 nM

Blocks several voltage-gated sodium channels with most potent activity on Nav1.71.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

Lyophilized

Contact Alomone Labs for technical support and product customization

ECRYWLGGCSKTGDCCEHLSCSPKWHWCVWDGTF-OH

Yes

12352202

yes

no