product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
OsK-1 Toxin
catalog :
STO-150
more info or order :
citations: 3
Reference
Fung Leung W, EDWARDS W, Liu Y, Ngo K, Angsana J, Castro G, et al. T Cell Subset and Stimulation Strength-Dependent Modulation of T Cell Activation by Kv1.3 Blockers. PLoS ONE. 2017;12:e0170102 pubmed publisher
Tegla C, Cudrici C, Rozycka M, Soloviova K, Ito T, Singh A, et al. C5b-9-activated, K(v)1.3 channels mediate oligodendrocyte cell cycle activation and dedifferentiation. Exp Mol Pathol. 2011;91:335-45 pubmed publisher
Fulton S, Thibault D, Mendez J, Lahaie N, Tirotta E, Borrelli E, et al. Contribution of Kv1.2 voltage-gated potassium channel to D2 autoreceptor regulation of axonal dopamine overflow. J Biol Chem. 2011;286:9360-72 pubmed publisher
product information
cat :
STO-150
SKU :
STO-150_0.1 mg
Product Name :
OsK-1 Toxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P55896
Accession Number :
https://www.uniprot.org/uniprotkb/P55896/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Orthochirus scrobiculosus (Central Asian scorpion)
Source :
Synthetic peptide
Gene ID :
KCNA1 ,KCNA2 ,KCNA3,KCNN4
Product Page - Scientific background :
OsK1 (α-KTx3.7) is a 38-residue toxin cross-linked by three disulphide bridges, originally isolated from the venom of the Asian scorpion Orthochirus scrobiculosus.1 The toxin was found to block a number of K+ channels, both voltage-dependent and Ca2+-activated isoforms. OsK-1 is lethal in mice by intracerebroventricular injection, with a LD50 value of 2 mg/kg. OsK-1 blocks mKV1.1, mKV1.2, mKV1.3 channels potently and hKCa3.1 channel moderately, with IC50 values of 0.6, 5.4, 0.014 and 225 nM, respectively.2 No inhibition effects were observed on KV1.4, KV1.5, KV1.6, KV1.7, KV11, KCa2.1, KCa2.2, KCa2.3 and KCa1.1 channels at µM concentrations.2
Supplier :
Alomone Labs
Target :
KV1.1, KV1.2, KV1.3, and KCa3.1 K+ channels
Long Description :
A Potent Blocker of KV1.3 and KCa3.1 K+ Channels
Short Description :
A Potent Blocker of KV1.3 and KCa3.1 K+ Channels
MW :
4205 Da
Synonyms :
K+ channel toxin α-KTx 3.7, OsK1
Modifications :
Disulfide bonds between: Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35
Molecular formula :
C177H300N56O46S8
Effective Concentration :
5 - 100 nM
Activity :
OsK-1 inhibits KV1.1, KV1.2, KV1.3 channels potently and KCa3.1 channel moderately1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
183815-75-0
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel