chemical

OsK-1 Toxin

STO-150

STO-150_0.1 mg

OsK-1 Toxin

Non Antibodies

Proteins

P55896

https://www.uniprot.org/uniprotkb/P55896/entry

Electrophysiology

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Orthochirus scrobiculosus (Central Asian scorpion)

Synthetic peptide

KCNA1 ,KCNA2 ,KCNA3,KCNN4

OsK1 (α-KTx3.7) is a 38-residue toxin cross-linked by three disulphide bridges, originally isolated from the venom of the Asian scorpion Orthochirus scrobiculosus.1 The toxin was found to block a number of K+ channels, both voltage-dependent and Ca2+-activated isoforms. OsK-1 is lethal in mice by intracerebroventricular injection, with a LD50 value of 2 mg/kg. OsK-1 blocks mKV1.1, mKV1.2, mKV1.3 channels potently and hKCa3.1 channel moderately, with IC50 values of 0.6, 5.4, 0.014 and 225 nM, respectively.2 No inhibition effects were observed on KV1.4, KV1.5, KV1.6, KV1.7, KV11, KCa2.1, KCa2.2, KCa2.3 and KCa1.1 channels at µM concentrations.2

Alomone Labs

KV1.1, KV1.2, KV1.3, and KCa3.1 K+ channels

A Potent Blocker of KV1.3 and KCa3.1 K+ Channels

A Potent Blocker of KV1.3 and KCa3.1 K+ Channels

4205 Da

K+ channel toxin α-KTx 3.7, OsK1

Disulfide bonds between: Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35

C177H300N56O46S8

5 - 100 nM

OsK-1 inhibits KV1.1, KV1.2, KV1.3 channels potently and KCa3.1 channel moderately1.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

183815-75-0

Lyophilized

Contact Alomone Labs for technical support and product customization

GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK-OH

Yes

12352202

yes

no