product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Noxiustoxin
catalog :
STN-340
more info or order :
citations: 1
Reference |
---|
McGahon M, Dawicki J, Arora A, Simpson D, Gardiner T, Stitt A, et al. Kv1.5 is a major component underlying the A-type potassium current in retinal arteriolar smooth muscle. Am J Physiol Heart Circ Physiol. 2007;292:H1001-8 pubmed
|
image
image 1 :

Alomone Labs GW441756 hydrochloride inhibits NGF-induced survival of PC12 cells. - PC12 cells were incubated for 24 hours with or without 2 nMNative mouse NGF 2.5S protein ( 95%)(#N-100) inducing 5 fold increase in cell numbers measured with XTT. Increasing concentrations ofGW441756hydrochloride(#G-191) induced dose dependent inhibition of the NGF effect with apparent IC50of about 2 M.
image 2 :

Alomone Labs Noxiustoxin inhibits KV1.3 channels heterologously expressed inXenopusoocytes. - Left: Time course of KV1.3 current amplitude in response to test pulses of 100 ms to 0 mV from a holding potential of -100 mV. 200 nMNoxiustoxin(#STN-340) was perfused at the period marked by the horizontal bar. Right: Traces of KV1.3 currents before (red) and during (black) application of Noxiustoxin.
product information
cat :
STN-340
SKU :
STN-340_0.1 mg
Product Name :
Noxiustoxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P08815
Accession Number :
https://www.uniprot.org/uniprotkb/P08815/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Centruroides noxius (Mexican scorpion)
Source :
Synthetic peptide
Gene ID :
KCNA1 ,KCNA2 ,KCNA3,KCNA5,KCNC1,KCNMA1 ,KCNN4
Product Page - Scientific background :
Noxiustoxin was originally isolated from the venom of the scorpion Centruroides noxius Hoffmann1 and was shown to interact and inhibit KV1.2 and KV1.3 K+ channels.2 The toxin blocks KV1.3 (recorded using patch clamp in Jurkat cells) with Kd of 6 nM3 It was shown to bind synaptosomal membranes4 and to increase transmitter release.5 In addition, it was shown to block K+ channels in lymphocytes.6
Supplier :
Alomone Labs
Target :
KV1.2, KV1.3 K+ channels
Long Description :
A Potent Blocker of KV1.2 and KV1.3 Channels
Short Description :
A Potent Blocker of KV1.2 and KV1.3 Channels
MW :
4195 Da
Synonyms :
K+ channel toxin α-KTx 2.1, NTx, Toxin II.11
Modifications :
Disulfide bonds between: Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36 Asn39 - C-terminal amidation
Molecular formula :
C174H286N52O54S7
Effective Concentration :
10 - 200 nM
Activity :
Noxiustoxin inhibits KV1.2 and KV1.3 K+ channels1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
85205-49-8
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
TIINVKCTSPKQCSKPCKELYGSSAGAKCMNGKCKCYNN-NH2
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments