chemical

MmTx1 Toxin-ATTO Fluor-488

STM-550-AG

STM-550-AG_10 mcg

MmTx1 Toxin-ATTO Fluor-488

Non Antibodies

Proteins

Electrophysiology, Live cell imaging, Immunofluorescence, Direct flow cytometry

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day. Avoid exposure to light.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is lyophilized in 0.5 ml conical vial. The product is soluble in pure water to high-micromolar concentrations (5 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is lyophilized in 0.5 ml conical vial. The product is soluble in pure water to high-micromolar concentrations (5 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Avoid exposure to light.

Micrurus mipartitus (Red-tailed coral snake)

Modified synthetic peptide

GABR,GABRA1,GABRB2

MmTx1 (Micrurotoxin 1) is a peptide toxin originally isolated from Micrurus mipartitus (Red-tailed coral snake) venoM The toxin is an allosteric modulator of γ-aminobutyric acid type A receptors (GABA(A)) and tightly binds to GABA(A) receptors at subnanomolar concentrations. MmTx1 allosterically increases GABA(A) receptor susceptibility to agonistic actions, thereby potentiating receptor opening and desensitization by interacting with the α+/β−interface, a benzodiazepine-like binding site1. MmTx1 may be a priceless tool in evoking seizures for testing novel antiepileptic drugs or as lead molecules for designing therapeutics that modulate GABA(A) receptor activity1.GABA(A) receptors belong to the cys-loop pentameric ligand-gated ion channel family. These receptors are major inhibitory neurotransmitter receptors in the brain and in the mammalian central nervous system and are responsible for the mediation of GABA action, a major inhibitory neurotransmitter, through the central nervous system2.

Alomone Labs

GABA(A) receptors

A Super Potent Allosteric Modulator of GABA(A) Receptors Conjugated to the Fluorescent Dye ATTO-488

A Super Potent Allosteric Modulator of GABA(A) Receptors Conjugated to the Fluorescent Dye ATTO-488

~7775 Da

Micrurotoxin 1

Disulfide bonds between: Cys3-Cys24, Cys6-Cys11, Cys17-Cys41, Cys45-Cys57, Cys58-Cys63 ATTO Fluor-488

200 - 400 nM

MmTx1 is a potent allosteric modulator of GABA(A) receptors1.

Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day. Avoid exposure to light.

1-2 Business Days

Israel/IL

Lyophilized

Contact Alomone Labs for technical support and product customization

LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHRGERIER
RCVANCPAFGSHDTSLLCCTRDNCN-OH

Yes

12352202

yes

no