product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
MmTx1 Toxin-ATTO Fluor-488
catalog :
STM-550-AG
more info or order :
image
image 1 :

Alomone Labs MDL 72222 blocks 5-HT3A receptors expressed in HEK 293T cells. - 5-HT3A receptor currents elicited with 10 M 5-HT delivered every 3 minutes.MDL 72222(#M-155) was applied 30 seconds before stimulation at 1 M as indicated and completely inhibited the 5-HT induced current in a dose dependent and reversible manner.
image 2 :

Alomone Labs MmTx1 Toxin ATTO-488 binds to rat cerebellum. - Rat cerebellum sections were incubated on ice for 2 hours with 30 nM MmTx1 Toxin-ATTO-488 (#STM-550-AG). Staining (green) was observed mainly in the granule layer (GL) and some labeling in the molecular layer (MOL). DAPI is used as the counterstain (blue). Images were acquired with a 40x objective of a confocal Zeiss LSM 710 microscope.
product information
cat :
STM-550-AG
SKU :
STM-550-AG_10 mcg
Product Name :
MmTx1 Toxin-ATTO Fluor-488
Group Type :
Non Antibodies
Product Type :
Proteins
Applications :
Electrophysiology, Live cell imaging, Immunofluorescence, Direct flow cytometry
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day. Avoid exposure to light.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is lyophilized in 0.5 ml conical vial. The product is soluble in pure water to high-micromolar concentrations (5 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is lyophilized in 0.5 ml conical vial. The product is soluble in pure water to high-micromolar concentrations (5 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Avoid exposure to light.
Origin :
Micrurus mipartitus (Red-tailed coral snake)
Source :
Modified synthetic peptide
Gene ID :
GABR,GABRA1,GABRB2
Product Page - Scientific background :
MmTx1 (Micrurotoxin 1) is a peptide toxin originally isolated from Micrurus mipartitus (Red-tailed coral snake) venoM The toxin is an allosteric modulator of γ-aminobutyric acid type A receptors (GABA(A)) and tightly binds to GABA(A) receptors at subnanomolar concentrations. MmTx1 allosterically increases GABA(A) receptor susceptibility to agonistic actions, thereby potentiating receptor opening and desensitization by interacting with the α+/β−interface, a benzodiazepine-like binding site1. MmTx1 may be a priceless tool in evoking seizures for testing novel antiepileptic drugs or as lead molecules for designing therapeutics that modulate GABA(A) receptor activity1.GABA(A) receptors belong to the cys-loop pentameric ligand-gated ion channel family. These receptors are major inhibitory neurotransmitter receptors in the brain and in the mammalian central nervous system and are responsible for the mediation of GABA action, a major inhibitory neurotransmitter, through the central nervous system2.
Supplier :
Alomone Labs
Target :
GABA(A) receptors
Long Description :
A Super Potent Allosteric Modulator of GABA(A) Receptors Conjugated to the Fluorescent Dye ATTO-488
Short Description :
A Super Potent Allosteric Modulator of GABA(A) Receptors Conjugated to the Fluorescent Dye ATTO-488
MW :
~7775 Da
Synonyms :
Micrurotoxin 1
Modifications :
Disulfide bonds between: Cys3-Cys24, Cys6-Cys11, Cys17-Cys41, Cys45-Cys57, Cys58-Cys63 ATTO Fluor-488
Effective Concentration :
200 - 400 nM
Activity :
MmTx1 is a potent allosteric modulator of GABA(A) receptors1.
Storage of solutions :
Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day. Avoid exposure to light.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHRGERIER
RCVANCPAFGSHDTSLLCCTRDNCN-OH
RCVANCPAFGSHDTSLLCCTRDNCN-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments