product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Mambalgin-3
catalog :
STM-500
more info or order :
image
image 1 :

Alomone Labs GW441756 inhibits NGF induced survival of PC12 cells. - PC12 cells were incubated for 24 hours with or without 2 nMNative mouse NGF 2.5S protein ( 95%)(#N-100) inducing 5 fold increase in cell numbers measured with XTT. Increasing concentrations ofGW441756(#G-190) induced dose dependent inhibition of the NGF effect with apparent IC50of about 2 M.
product information
cat :
STM-500
SKU :
STM-500_0.1 mg
Product Name :
Mambalgin-3
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
C0HJB0
Accession Number :
https://www.uniprot.org/uniprotkb/C0HJB0/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Dendroaspis angusticeps (Eastern green mamba) (Naja angusticeps)
Source :
Synthetic protein
Gene ID :
ASIC1a,ASIC1b
Product Page - Scientific background :
Mambalgin-3 is a peptide toxin originally isolated from the green mamba (Dendroaspis augusticeps) snake venom1. The toxin inhibits rat ASIC1a (IC50 = 17 nM), ASIC1b (IC50 = 44 nM) and heteromeric ASIC1a-ASIC2a (IC50 = 252 nM) channels1.Acid-sensing ion channels (ASICs) are voltage-independent proton-gated cation channels that are largely expressed in the nervous system as well as in some non-neuronal tissues. In rodents, six different isoforms (ASIC1a, 1b, 2a, 2b, 3 and 4) can associate into homo- or hetero-trimers to form a functional channel1.Mambalgins define a new structural and functional class among snake three-finger toxins. These type of toxins are found in snake venoms (Mambalgin1 and 2 were originally isolated from black mambas) and are characterized by their distinctive structure2. Mambalgins are the only three-finger toxins to target ASIC channels and show no neurotoxic effect. These three-finger toxins show an analgesic effect against acute and inflammatory pain upon central and peripheral injection that can be as strong as morphine. Mambalgins cause much less tolerance than morphine and no respiratory distress3.
Supplier :
Alomone Labs
Target :
ASIC1a and ASIC1b channels
Long Description :
A Blocker of ASIC1a and ASIC1b Channels
Short Description :
A Blocker of ASIC1a and ASIC1b Channels
MW :
6566.6 Da
Synonyms :
Mamb-3
Modifications :
Disulfide bonds between: Cys3-Cys19, Cys12-Cys37, Cys41-Cys49 and Cys50-Cys55
Molecular formula :
C274H433N85O83S10
Effective Concentration :
10 - 50 nM
Activity :
A blocker of ASIC1-containing channels1,2.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
LKCYQHGKVVTCHRDMKFCYHNIGMPFRNLKLILQGCSS
SCSETENNKCCSTDRCNK-OH
SCSETENNKCCSTDRCNK-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments