chemical

Mambalgin-2

STM-400

STM-400_0.1 mg

Mambalgin-2

Non Antibodies

Proteins

P0DKS3

https://www.uniprot.org/uniprotkb/P0DKS3/entry

Electrophysiology

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Dendroaspis polylepis polylepis (Black mamba)

Synthetic protein

ASIC1a

Mambalgin-2 is a peptide toxin originally isolated from Dendroaspis polylepis (Black mamba) venoM It is a selective and potent ASIC1a blocker2. Mambalgins belong to the three-finger toxin family, albeit their limited structural similarity3. Molecular docking of mambalgin-2 is predicted to interact with the acidic binding pocket of ASIC1a2. Further mutagenesis studies in chimeric proteins uncovered the interactions of mambalgin-2 with β-ball and Palm regions of ASIC1a that are associated with a pH sensing property2.Acid-sensing ion channels (ASICs) are proton-gated sodium channels1. They are abundant in the central as well as in the peripheral nervous systems and are sensitive to environmental pH1.Environmental pH can change dramatically due to certain circumstances such as inflammatory condition as evident during epileptic seizures or tumor outgrowth3. In such cases, ASICs transform into their open conformation and import sodium ions, which then elicit neuronal action potential3.

Alomone Labs

ASIC1 Channels

A Selective and Reversible ASIC1a Channel Blocker

A Selective and Reversible ASIC1a Channel Blocker

6538.6 Da

Ma-2, Mamb-2, Pi-Dp2

Disulfide bonds between: Cys3-Cys19, Cys41-Cys49 and Cys50-Cys55

C272H429N85O83S10

20 - 300 nM

Mambalgin-2 is a blocker of ASIC1 channels1.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

Lyophilized

Contact Alomone Labs for technical support and product customization

LKCFQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSS
SCSETENNKCCSTDRCNK-OH

Yes

12352202

yes

no