product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Maurotoxin
catalog :
STM-340
more info or order :
citations: 18
| Reference |
|---|
Kasten M, Rudy B, Anderson M. Differential regulation of action potential firing in adult murine thalamocortical neurons by Kv3.2, Kv1, and SK potassium and N-type calcium channels. J Physiol. 2007;584:565-82 pubmed
|
image
image 1 :

Alomone Labs Maurotoxin inhibits KV1.2 channels heterologously expressed inXenopusoocytes. - A. Superimposed example traces of KV1.2 channel currents in response to ramp depolarization (from -80 mV to 40 mV during 100 msec) before (black) and during the application of increasing concentrations ofMaurotoxin(#STM-340) (inset) for 100 sec. B. Example of time course showing fast and reversible effect of 2 nM Maurotoxin on the current amplitude (as extracted from the ramp responses at 0 mV).
product information
cat :
STM-340
SKU :
STM-340_0.1 mg
Product Name :
Maurotoxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P80719
Accession Number :
https://www.uniprot.org/uniprotkb/P80719/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Scorpio palmatus (Israeli golden scorpion) (Scorpio maurus palmatus)
Source :
Synthetic peptide
Gene ID :
KCNA1 ,KCNA2 ,KCNA3,KCNN4
Product Page - Scientific background :
Maurotoxin (MTX) is a 34 amino acid long toxin, isolated from the venom of the scorpion Scorpio Maurus palmatus, and is classified as α-KTx6.2 scorpion toxin family, having four disulfide bridges1,2.MTX activity was extensively assayed on a large array of K+ channels, including KCa (KCa1.1, KCa2.1, KCa2.2, KCa3.1), KV1 (KV1.1, KV1.2 and KV1.3) and Shaker-B K+ currents. MTX inhibits the binding of 125I-Apamin and 125I-Kaliotoxin to rat brain synaptosomal membranes with an IC50 of 5 nM and 30 pM, respectively3. Furthermore, MTX blocks KCNA1 (KV1.1), KCNA2 (KV1.2) and KCNA3 (KV1.3) expressed in Xenopus oocyes with an IC50 of 45 nM, 0.8 nM, and 180 nM, respectively3. Maurotoxin blocks Shaker-B K+ current with an IC50 of 2 nM4. In contrast to previous reports, MTX was recently shown to have no effect on KCa1.1, KCa2.1 and KCa2.2 small conductance KCa channels up to 300 nM in physiologically relevant ionic strength buffers, but rather produces a high and specific block towards KCa3.1 (IKca1, SK4) and KCNA2 (KV1.2) with IC50 of 1 nM and 0.1 nM, respectively5. Furthermore, MTX was shown to block Gardos channel in human red blood cells and to inhibit the KCa in activated human T-lymphocytes without affecting the voltage-gated K+ current encoded by KCNA35. Moreover, MTX inhibition was shown to be pH-dependent6,7.In conclusion, Maurotoxin seems to be a very potent blocker of both KCa3.1 and KV1.2 channels.
Supplier :
Alomone Labs
Target :
KCa and KV1 K+ channels
Long Description :
A Potent Blocker of KCa and KV1 K+ Channels
Short Description :
A Potent Blocker of KCa and KV1 K+ Channels
MW :
3612 Da
Synonyms :
K+ channel toxin α-KTx 6.2, MTX
Modifications :
Disulfide bonds between: Cys3-Cys24, Cys9-Cys29, Cys13-Cys19 and Cys31-Cys34 Cys34 - C-terminal amidation
Molecular formula :
C145H232N46O46S8
Effective Concentration :
1 - 200 nM
Activity :
Maurotoxin activity was extensively assayed on a large array of K+ channels, including KCa (KCa1.1, KCa2.1, KCa2.2, KCa2.2, KCa3.1), KCNA (KCNA1, KCNA2 and KCNA3) and Shaker-B K+ currents and seems to be very potent blocker of either KCa3.1 and KCNA2 channels1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
>99% (HPLC)
CAS No :
188240-41-7
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
VSCTGSKDCYAPCRKQTGCPNAKCINKSCKCYGC-NH2
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments
