product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Margatoxin
catalog :
STM-325
more info or order :
citations: 24
| Reference |
|---|
Fellerhoff Losch B, Korol S, Ganor Y, Gu S, Cooper I, Eilam R, et al. Normal human CD4(+) helper T cells express Kv1.1 voltage-gated K(+) channels, and selective Kv1.1 block in T cells induces by itself robust TNFα production and secretion and activation of the NFκB non-canonical pathway. J Neural Transm (Vienna). 2016;123:137-57 pubmed publisher
|
image
image 1 :
Alomone Labs Margatoxininhibits KV1.3 currents expressed inXenopusoocytes. - A. Time course ofMargatoxin(#STM-325) action on Kv1.3 currents. Current amplitudes were plotted as a function of time. Membrane potential was held at ?100 mV and oocytes were stimulated by a 100 ms voltage ramp to +60 mV. 0.5 nM Margatoxin were perfused as indicated by the bar (green) at + 55 mV for 180 sec. B. Superimposed examples of KV1.3 channel current in the absence (control) and presence (green) of 0.5 nM Margatoxin (taken from the experiment in A).
product information
cat :
STM-325
SKU :
STM-325_0.1 mg
Product Name :
Margatoxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P40755
Accession Number :
https://www.uniprot.org/uniprotkb/P40755/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Centruroides margaritatus (Central American bark Scorpion)
Source :
Synthetic peptide
Gene ID :
KCNA1 ,KCNA2 ,KCNA3,KCNA6
Product Page - Scientific background :
Margatoxin is a peptidyl toxin originally isolated from the scorpion Centruroides margaritatus. It is a specific blocker of KV1.3 channels (IC50~30 pM), but it also blocks KV1.6 and a splice variant of the Drosophila Shaker channels with IC50 of 5 and 150 nM respectively.2 In Xenopus oocytes the toxin is less potent and inhibits expressed KV1.3 channels with an apparent IC50 of ~1 nM2
Supplier :
Alomone Labs
Target :
KV1.3, KV1.6 K+ channels
Long Description :
A Blocker KV1.3 and KV1.6 K+ Channels
Short Description :
A Blocker KV1.3 and KV1.6 K+ Channels
MW :
4179 Da
Synonyms :
Potassium channel toxin α-KTx 2.2, MgTX-theraphotoxin-Hh2a, MgTX
Modifications :
Disulfide bonds between: Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36
Molecular formula :
C178H286N52O50S7
Effective Concentration :
50 pM - 50 nM
Activity :
Margatoxin is a blocker of KV1.3 and KV1.6 channels.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
145808-47-5
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
Cited Application :
Electrophysiology
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments