product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Muscarinic Toxin 7
catalog :
STM-200
more info or order :
citations: 3
Reference |
---|
product information
cat :
STM-200
SKU :
STM-200_0.1 mg
Product Name :
Muscarinic Toxin 7
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
Q8QGR0
Accession Number :
https://www.uniprot.org/uniprotkb/Q8QGR0/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Dendroaspis angusticeps (Eastern green mamba) (Naja angusticeps)
Source :
Synthetic protein
Gene ID :
CHRM1
Product Page - Scientific background :
The action of the neurotransmitter acetylcholine (Ach) is mediated through two types of receptors, the ionotropic nicotinic receptors and the metabotropic muscarinic receptors. The muscarinic receptors belong to the superfamily of G-protein coupled receptors. Five subtypes of muscarinic receptors have been cloned: m1-m51,2.The muscarinic receptors are widely distributed throughout the body, but are predominantly expressed within the parasympathetic nervous system and exert both excitatory and inhibitory control over central and peripheral tissues1,2.Muscarinic receptors participate in a number of physiological functions such as regulation of heart rate, muscle contraction, cognition, sensory processing and motor control1. They also participate in learning and memory processing3,4.Muscarinic Toxin 7 is a 65 amino acid peptide toxin isolated from the Dendroaspis angusticeps (Eastern green mamba)5. It was first found to inhibit M1 muscarinic receptors stably transfected in CHO cells at very low concentrations (1-30 nM)6 and acts as a non-competitive antagonist by binding to an allosteric site6.Muscarinic Toxin 7 binding studies using a M1 and M3 chimera demonstrated that the high affinity of Muscarinic Toxin 7 towards M1 receptor is due to only three residues located in the 2nd and 3rd extracellular loops of the receptor7.
Supplier :
Alomone Labs
Target :
M1 muscarinic receptor
Long Description :
An Antagonist of M1 Muscarinic Receptor
Short Description :
An Antagonist of M1 Muscarinic Receptor
MW :
7472.5 Da
Synonyms :
Muscarinic toxin-7, MT7, muscarinic m1-toxin, m1-toxin1
Modifications :
Disulfide bonds between: Cys3-Cys24, Cys17-Cys42, Cys46-Cys57, Cys58-Cys63
Molecular formula :
C322H484N90O98S9
Effective Concentration :
1 - 100 nM
Activity :
Uncompetitive antagonist of M1 AChR1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
135541-77-4
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
LTCVKSNSIWFPTSEDCPDGQNLCFKRWQYISPRMYDFT
RGCAATCPKAEYRDVINCCGTDKCNK-OH
RGCAATCPKAEYRDVINCCGTDKCNK-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
related products
browse more products
questions and comments