chemical

Mambalgin-1

STM-100

STM-100_0.1 mg

Mambalgin-1

Non Antibodies

Proteins

P0DKR6

https://www.uniprot.org/uniprotkb/P0DKR6/entry

Electrophysiology

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Dendroaspis polylepis polylepis (Black mamba)

Synthetic protein

ASIC1a

Mambalgin-1 is a 57-residue peptide toxin originally isolated from the black mamba snake venoM It is a selective and reversible acid-sensing ion channel 1 (ASIC1) channel blocker. It binds to the closed state of the channel. The binding induces strong shift of the pH-dependent activation of ASIC1 channel towards a more acidic pH. Mambalgin-1 inhibits homomeric rat ASIC1a, rat ASIC1b, and heteromeric rat ASIC1a + ASIC2a channels heterologously expressed in Xenopus oocytes with an IC50 values of 3.4 ± 0.6, 22.2 ± 1.7, and 152 ± 21 nM, respectively2.In mice, Mambalgin-1 is not toxic, but poses analgesic effects upon central and peripheral injection found to be as strong as morphine1,2.ASIC channels are proton-gated Na+ channels directly activated by extracellular protons. They are expressed throughout the CNS and the peripheral nervous systeM The channels are involved in a variety of physiological and pathophysiological processes including synaptic plasticity, neuronal injury, nociception and mechanoperception2.

Alomone Labs

ASIC1 channels

A Selective and Reversible ASIC1a Blocker

A Selective and Reversible ASIC1a Blocker

6554.6 Da

Mamb-1, Pi-Dp1, Mambalgin 1

Disulfide bonds between: Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38

C272H429N85O84S10

50 - 200 nM

Mambalgin-1 is a blocker of ASIC1 channels1,2.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

1609937-15-6

Lyophilized

Contact Alomone Labs for technical support and product customization

LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSS
SCSETENNKCCSTDRCNK-OH

Yes

12352202

yes

no