product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Mambalgin-1
catalog :
STM-100
more info or order :
image
image 1 :

Expression of MRGD in rat DRG - Immunohistochemical staining of rat dorsal root ganglion (DRG) sections usingAnti-MRGPRD (GPCR TGR7) Antibody(#AMR-061) (1:200) followed by goat-anti rabbit-AlexaFluor-488. MRGD staining (green) appears in several DRGs (arrows). Cell nuclei are stained with DAPI (blue).
product information
cat :
STM-100
SKU :
STM-100_0.1 mg
Product Name :
Mambalgin-1
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P0DKR6
Accession Number :
https://www.uniprot.org/uniprotkb/P0DKR6/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Dendroaspis polylepis polylepis (Black mamba)
Source :
Synthetic protein
Gene ID :
ASIC1a
Product Page - Scientific background :
Mambalgin-1 is a 57-residue peptide toxin originally isolated from the black mamba snake venoM It is a selective and reversible acid-sensing ion channel 1 (ASIC1) channel blocker. It binds to the closed state of the channel. The binding induces strong shift of the pH-dependent activation of ASIC1 channel towards a more acidic pH. Mambalgin-1 inhibits homomeric rat ASIC1a, rat ASIC1b, and heteromeric rat ASIC1a + ASIC2a channels heterologously expressed in Xenopus oocytes with an IC50 values of 3.4 ± 0.6, 22.2 ± 1.7, and 152 ± 21 nM, respectively2.In mice, Mambalgin-1 is not toxic, but poses analgesic effects upon central and peripheral injection found to be as strong as morphine1,2.ASIC channels are proton-gated Na+ channels directly activated by extracellular protons. They are expressed throughout the CNS and the peripheral nervous systeM The channels are involved in a variety of physiological and pathophysiological processes including synaptic plasticity, neuronal injury, nociception and mechanoperception2.
Supplier :
Alomone Labs
Target :
ASIC1 channels
Long Description :
A Selective and Reversible ASIC1a Blocker
Short Description :
A Selective and Reversible ASIC1a Blocker
MW :
6554.6 Da
Synonyms :
Mamb-1, Pi-Dp1, Mambalgin 1
Modifications :
Disulfide bonds between: Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38
Molecular formula :
C272H429N85O84S10
Effective Concentration :
50 - 200 nM
Activity :
Mambalgin-1 is a blocker of ASIC1 channels1,2.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
1609937-15-6
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSS
SCSETENNKCCSTDRCNK-OH
SCSETENNKCCSTDRCNK-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments
