product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Kurtoxin
catalog :
STK-800
more info or order :
citations: 1
image
image 1 :

product information
cat :
STK-800
SKU :
STK-800_0.1 mg
Product Name :
Kurtoxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P58910
Accession Number :
https://www.uniprot.org/uniprotkb/P58910/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Parabuthus transvaalicus (South African fattail scorpion)
Source :
Synthetic protein
Gene ID :
CACNA1G,CACNA1H,CACNA1I
Product Page - Scientific background :
Kurtoxin is a peptide toxin originally isolated from the South African scorpion (Parabuthus transvaalicus) venom, and was the first characterized ligand for low voltage-gated calcium channels1,2. Kurtoxin potently blocks CaV3.1 and CaV3.2 channels displaying effective working concentrations as low as 50 nMAlthough Kurtoxin is very similar to other scorpion isolated toxins (also known as α-toxins) that target sodium channels, detailed NMR analyses uncovered a unique configuration that distinguishes it from α-toxins and, therefore, is believed to be essential for Kurtoxin's binding ability3.CaV3.1 and CaV3.2 are members of the T-type calcium channels that regulate calcium intake near resting membrane potential1. Members of the CaV3 ion channels control cardiac pacemaking, but may also play a role outside the nervous system as predicted by their overall distribution in the body1.
Supplier :
Alomone Labs
Target :
CaV3.1, CaV3.2 channels
Long Description :
A Selective and Potent Blocker of CaV3.1 and CaV3.2 Channels
Short Description :
A Selective and Potent Blocker of CaV3.1 and CaV3.2 Channels
MW :
7386.5 Da
Synonyms :
Ktx
Modifications :
Disulfide bonds between: Cys12-Cys61, Cys16-Cys37, Cys23-Cys44, and Cys27-Cys46
Molecular formula :
C324H478N94O90S8
Effective Concentration :
10 - 200 nM
Activity :
Kurtoxin is a CaV3.1 and CaV3.2 channel blocker1,2.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
820959-57-7
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
KIDGYPVDYWNCKRICWYNNKYCNDLCKGLKADSGYCWG
WTLSCYCQGLPDNARIKRSGRCRA-OH
WTLSCYCQGLPDNARIKRSGRCRA-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
- Anti-ACE2 (extracellular) Antibody | AAC-012
- Anti-Adenosine A2B Receptor (extracellular)-APC Antibody | AAR-003-APC
- Anti-Adenosine A2A Receptor (extracellular)-FITC Antibody | AAR-008-F
- Anti-Adenosine A2A Receptor (extracellular)-PE Antibody | AAR-008-PE
- Guinea pig Anti-Angiotensin-(1-7) Mas Receptor Antibody | AAR-013-GP
questions and comments
