chemical

Kurtoxin

STK-800

STK-800_0.1 mg

Kurtoxin

Non Antibodies

Proteins

P58910

https://www.uniprot.org/uniprotkb/P58910/entry

Electrophysiology

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Parabuthus transvaalicus (South African fattail scorpion)

Synthetic protein

CACNA1G,CACNA1H,CACNA1I

Kurtoxin is a peptide toxin originally isolated from the South African scorpion (Parabuthus transvaalicus) venom, and was the first characterized ligand for low voltage-gated calcium channels1,2. Kurtoxin potently blocks CaV3.1 and CaV3.2 channels displaying effective working concentrations as low as 50 nMAlthough Kurtoxin is very similar to other scorpion isolated toxins (also known as α-toxins) that target sodium channels, detailed NMR analyses uncovered a unique configuration that distinguishes it from α-toxins and, therefore, is believed to be essential for Kurtoxin's binding ability3.CaV3.1 and CaV3.2 are members of the T-type calcium channels that regulate calcium intake near resting membrane potential1. Members of the CaV3 ion channels control cardiac pacemaking, but may also play a role outside the nervous system as predicted by their overall distribution in the body1.

Alomone Labs

CaV3.1, CaV3.2 channels

A Selective and Potent Blocker of CaV3.1 and CaV3.2 Channels

A Selective and Potent Blocker of CaV3.1 and CaV3.2 Channels

7386.5 Da

Ktx

Disulfide bonds between: Cys12-Cys61, Cys16-Cys37, Cys23-Cys44, and Cys27-Cys46

C324H478N94O90S8

10 - 200 nM

Kurtoxin is a CaV3.1 and CaV3.2 channel blocker1,2.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

820959-57-7

Lyophilized

Contact Alomone Labs for technical support and product customization

KIDGYPVDYWNCKRICWYNNKYCNDLCKGLKADSGYCWG
WTLSCYCQGLPDNARIKRSGRCRA-OH

Yes

12352202

yes

no