product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Kaliotoxin-1
catalog :
STK-370
more info or order :
citations: 2
Reference
Fellerhoff Losch B, Korol S, Ganor Y, Gu S, Cooper I, Eilam R, et al. Normal human CD4(+) helper T cells express Kv1.1 voltage-gated K(+) channels, and selective Kv1.1 block in T cells induces by itself robust TNFα production and secretion and activation of the NFκB non-canonical pathway. J Neural Transm (Vienna). 2016;123:137-57 pubmed publisher
Al Sabi A, Shamotienko O, Dhochartaigh S, Muniyappa N, Le Berre M, Shaban H, et al. Arrangement of Kv1 alpha subunits dictates sensitivity to tetraethylammonium. J Gen Physiol. 2010;136:273-82 pubmed publisher
image
image 1 :
Alomone Labs STK-370 image 1
Alomone Labs Kaliotoxin-1 inhibits KV1.3 channels heterologously expressed inXenopusoocytes. - Currents were elicited by application of voltage ramp from a holding potential of -80 mV to 50 mV in 100 msec delivered every 10 seconds. A. Time course of channel activity (current amplitude at 0 mV) before (black) and during (green) application of 1 nMKaliotoxin-1(#STK-370). B. Top illustration of the voltage ramp protocol. Bottom example of superimposed current traces before (black) and during (green) application of 1 nM Kaliotoxin-1 taken from the experiment in A.
image 2 :
Alomone Labs STK-370 image 2
Western blot analysis of rat dorsal root ganglion (lanes 1 and 4) mouse testis (lanes 2 and 5) and rat testis (lanes 3 and 6) lysates: - 1-3.Anti-MRGPRD (GPCR TGR7) Antibody(#AMR-061) (1:400).4-6. Anti-MRGPRD (GPCR TGR7) Antibody preincubated with the negative control antigen.
product information
cat :
STK-370
SKU :
STK-370_0.1 mg
Product Name :
Kaliotoxin-1
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P24662
Accession Number :
https://www.uniprot.org/uniprotkb/P24662/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Androctonus mauritanicus mauritanicus (Scorpion)
Source :
Synthetic peptide
Gene ID :
KCNA1 ,KCNA2 ,KCNA3,KCNMA1
Product Page - Scientific background :
Kaliotoxin-1 is a 38 amino acid long toxin, originally isolated from the venom of Androctonus mauretanicus mauretanicus scorpion and is classified as α-KTX 3.1 scorpion toxin family, having three disulfide bridges1,2.Kaliotoxin-1 is a potent inhibitor of large conductance Ca2+-activated K+ channels (BKCa)3, and it also binds and inhibits Dendrotoxin-sensitive voltage-dependent K+ channels, mainly KV1.1 (KCNA1), KV1.2 (KCNA2) and KV1.3 (KCNA3) with a Kd of 1.5, 25 and 0.1 nM, respectively4-6. Its binding affinity to rat brain synaptosomes is 5-fold higher than that of Kaliotoxin-37.The 3D structure of Kaliotoxin was determined by NMR spectroscopy and showed significant differences from structures established for other related scorpion toxins8,9.In vivo application of Kaliotoxin was shown to facilitate cognitive processes such as learning in rats10.
Supplier :
Alomone Labs
Target :
KCa1.1 and some KV1 K+ channels
Long Description :
A Powerful Blocker of KCa1.1 and certain KV1 Channels
Short Description :
A Powerful Blocker of KCa1.1 and certain KV1 Channels
MW :
4149 Da
Synonyms :
K+ channel toxin α-KTx 3.1, KTX-1
Modifications :
Disulfide bonds between Cys8-Cys28, Cys14-Cys33, and Cys18-Cys35 Lys38 - C-terminal amidation.
Molecular formula :
C171H284N56O48S6
Effective Concentration :
10 - 100 nM
Activity :
Kaliotoxin-1 is a potent inhibitor of large conductance Ca2+-activated K+ channels (BKCa)1,2. Kaliotoxin-1 also binds the dendrotoxin sensitive voltage-dependent K+ channels (KV1.1, KV1.2 and KV1.3 nM)3.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
145199-73-1
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK-NH2
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel