Kaliotoxin-1 | Alomone Labs STK-370 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

Kaliotoxin-1

catalog :

STK-370

more info or order :

Alomone Labs product webpage

citations: 2

Reference
Fellerhoff Losch B, Korol S, Ganor Y, Gu S, Cooper I, Eilam R, et al. Normal human CD4(+) helper T cells express Kv1.1 voltage-gated K(+) channels, and selective Kv1.1 block in T cells induces by itself robust TNFÎ± production and secretion and activation of the NFÎºB non-canonical pathway. J Neural Transm (Vienna). 2016;123:137-57 pubmed publisher
Al Sabi A, Shamotienko O, Dhochartaigh S, Muniyappa N, Le Berre M, Shaban H, et al. Arrangement of Kv1 alpha subunits dictates sensitivity to tetraethylammonium. J Gen Physiol. 2010;136:273-82 pubmed publisher

image

image 1 :

Alomone Labs Kaliotoxin-1 inhibits KV1.3 channels heterologously expressed inXenopusoocytes. - Currents were elicited by application of voltage ramp from a holding potential of -80 mV to 50 mV in 100 msec delivered every 10 seconds. A. Time course of channel activity (current amplitude at 0 mV) before (black) and during (green) application of 1 nMKaliotoxin-1(#STK-370). B. Top illustration of the voltage ramp protocol. Bottom example of superimposed current traces before (black) and during (green) application of 1 nM Kaliotoxin-1 taken from the experiment in A.

image 2 :

Western blot analysis of rat dorsal root ganglion (lanes 1 and 4) mouse testis (lanes 2 and 5) and rat testis (lanes 3 and 6) lysates: - 1-3.Anti-MRGPRD (GPCR TGR7) Antibody(#AMR-061) (1:400).4-6. Anti-MRGPRD (GPCR TGR7) Antibody preincubated with the negative control antigen.

product information

cat :

STK-370

SKU :

STK-370_0.1 mg

Product Name :

Kaliotoxin-1

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P24662

Accession Number :

https://www.uniprot.org/uniprotkb/P24662/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Androctonus mauritanicus mauritanicus (Scorpion)

Source :

Synthetic peptide

Gene ID :

KCNA1 ,KCNA2 ,KCNA3,KCNMA1

Product Page - Scientific background :

Kaliotoxin-1 is a 38 amino acid long toxin, originally isolated from the venom of Androctonus mauretanicus mauretanicus scorpion and is classified as α-KTX 3.1 scorpion toxin family, having three disulfide bridges1,2.Kaliotoxin-1 is a potent inhibitor of large conductance Ca2+-activated K+ channels (BKCa)3, and it also binds and inhibits Dendrotoxin-sensitive voltage-dependent K+ channels, mainly KV1.1 (KCNA1), KV1.2 (KCNA2) and KV1.3 (KCNA3) with a Kd of 1.5, 25 and 0.1 nM, respectively4-6. Its binding affinity to rat brain synaptosomes is 5-fold higher than that of Kaliotoxin-37.The 3D structure of Kaliotoxin was determined by NMR spectroscopy and showed significant differences from structures established for other related scorpion toxins8,9.In vivo application of Kaliotoxin was shown to facilitate cognitive processes such as learning in rats10.

Supplier :

Alomone Labs

Target :

KCa1.1 and some KV1 K+ channels

Long Description :

A Powerful Blocker of KCa1.1 and certain KV1 Channels

Short Description :

A Powerful Blocker of KCa1.1 and certain KV1 Channels

MW :

4149 Da

Synonyms :

K+ channel toxin α-KTx 3.1, KTX-1

Modifications :

Disulfide bonds between Cys8-Cys28, Cys14-Cys33, and Cys18-Cys35 Lys38 - C-terminal amidation.

Molecular formula :

C171H284N56O48S6

Effective Concentration :

10 - 100 nM

Activity :

Kaliotoxin-1 is a potent inhibitor of large conductance Ca2+-activated K+ channels (BKCa)1,2. Kaliotoxin-1 also binds the dendrotoxin sensitive voltage-dependent K+ channels (KV1.1, KV1.2 and KV1.3 nM)3.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

CAS No :

145199-73-1

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK-NH2

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage