product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
KTX-Sp2
catalog :
STK-050
more info or order :
product information
cat :
STK-050
SKU :
STK-050_0.1 mg
Product Name :
KTX-Sp2
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P0DQN5
Accession Number :
https://www.uniprot.org/uniprotkb/P0DQN5/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Scorpiops pococki (Scorpion)
Source :
Synthetic peptide
Gene ID :
KCNA1 ,KCNA2 ,KCNA3
Product Page - Scientific background :
a-KTX 12 Sp2 (KTX-Sp2) is a 37 amino acid peptidyl toxin, which was originally screened and genetically engineered from the venom gland transcriptome database from the scorpion, Scorpiops Pocoki1. KTX-Sp2 effectively blocks the voltage-gated potassium (Kv) channel Kv1.3, and also weakly inhibits the Kv1.1 and Kv1.2 channels1. In a Jurkat T cell model system, KTX-Sp2 significantly reduced the levels of intracellular free calcium, inhibited cellular activation, and suppressed the release of the inflammatory cytokine interleukin (IL)-2, which exhibited a robust immunosuppressant effect1.Kv channels play key roles in human physiology and pathology. The therapeutic targeting of KV1.3 with specific peptides and small molecule inhibitors shows great promise for treating various cancers and autoimmune diseases, such as multiple sclerosis, type I diabetes mellitus, psoriasis, contact dermatitis, rheumatoid arthritis, and myasthenia gravis2,3,4. In addition, the Kv1.3 channel in T lymphocytes is a validated therapeutic target for diverse autoimmune diseases5 and Ktx-Sp2 robustly inhibits the autoimmune response1.
Supplier :
Alomone Labs
Target :
Kv1.3, Kv1.2, Kv1.1
Long Description :
A Potent Blocker of KV1.3 and a weaker blocker of KV1.1 and KV1.2
Short Description :
A Potent Blocker of KV1.3 and a weaker blocker of KV1.1 and KV1.2
MW :
3928.5 Da
Synonyms :
Potassium channel toxin alpha-KTX 12 Sp2
Modifications :
Disulfide bonds between: Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35
Molecular formula :
C155H244N58O49S7
Effective Concentration :
15 - 100 nM
Activity :
KTX-Sp2 is a potent blocker of Kv1.3 voltage-gated K+ channels and a weaker inhibitor of Kv1.1 and Kv1.2 channel1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
SPLHGAKCSSSNQCTRPCRYGGGTHGKCMNGRCRCYG-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel