product summary
Loading...
company name :
Alomone Labs
product type :
protein
product name :
Osu1 Toxin
catalog :
STK-010
more info or order :
product information
cat :
STK-010
SKU :
STK-010_0.1 mg
Product Name :
Osu1 Toxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
C0HLR8
Accession Number :
https://www.uniprot.org/uniprotkb/C0HLR8/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Oculicosa supermirabilis (Central Asian wolf-spider)
Source :
Synthetic protein
Gene ID :
KCNA5
Product Page - Scientific background :
Kappa-lycotoxin-Os1a (Osu1 Toxin) is a 64-amino acid peptidyl toxin derived from the venom of the spider Oculicosa supermirabilis1. Osu1 exhibits inhibitory activity at the hKv1.5 channel and slows the activation kinetics of the Kv1.5 current at ~µM peptide concentration. The mode of action of Osu1 toxin involves binding to the voltage-sensing domain of the hKv1.5 potassium channel rather than occluding its pore. This binding effectively prevents the channel's opening at physiological membrane potentials, resulting in the inhibition of the ultra-rapid delayed rectifier potassium current (IKur). Consequently, this prolongs atrial action potentials, potentially leading to the termination of atrial fibrillation (AF)1,2. The hKv1.5 channel is selectively expressed in human atrial myocytes and is absent in ventricular tissues, reducing the likelihood of ventricular side effects. Osu1 toxin demonstrates a high affinity for hKv1.5, and this specificity makes it a promising candidate for selective AF therapies1,2. The potential applications of Osu1 toxin extend beyond AF. Its unique properties make it a valuable tool for studying ion channel physiology and hold promise for the development of toxin-based therapeutics. Osu1's ability to prolong atrial action potentials without affecting ventricular tissues further highlights its therapeutic relevance1,2.
Supplier :
Alomone Labs
Target :
Kv1.5 channels
MW :
7477.7 Da
Synonyms :
Kappa-lycotoxin-Os1a, Kappa-LCTX-Os1a, Toxin Osu1
Modifications :
Disulfide bonds between: Cys10-Cys26, Cys28-Cys40, Cys17-Cys42, Cys19-Cys56
Molecular formula :
C332H487N101O83S8
Effective Concentration :
0.3 - 4 µM
Activity :
Osu1 Toxin acts as the modifier and inhibitor of hKV1.5 ion current1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥ 97% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
RLALPPGAVCNGHKSDCQCFGAKYKCSCPFFWRFRKSAE
CHCKKGWAWTAIKKRSCHNRYQWSD-OH
CHCKKGWAWTAIKKRSCHNRYQWSD-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments