chemical

Jingzhaotoxin-34

STJ-500

STJ-500_0.1 mg

Jingzhaotoxin-34

Non Antibodies

Proteins

B1P1F7

https://www.uniprot.org/uniprotkb/B1P1F7/entry

Electrophysiology

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys jingzhao)

Synthetic peptide

SCN1A,SCN3A, SCN9A

Jingzhaotoxin-34 (JZTX-34) is a 35 amino acid peptidyl toxin, originally isolated from the venom of the Chinese earth tiger tarantula, Chilobrachys guangxiensis1,2.JzTx-34 was reported first as a potent and selective blocker of the voltage-gated sodium (NaV) 1.7 channel and a weak blocker of the Nav1.3 channel3. Recently, it has been found that JzTx-34 has more potent activity as an activator of hNav1.14. In addition, at higher concentrations than hNav1.1, this toxin activated hNav1.3 and hNav1.6 channels and also blocked hNav1.2, hNav1.4, hNav1.5, hNav1.7, and hERG channels4. Moreover, JzTx-34 inhibited voltage-gated potassium (Kv) channels in rat DRG neurons3.Nav channels are transmembrane proteins that control the voltage-dependent increase in sodium permeability. They play a fundamental role in normal neurological function, especially in the initiation and propagation of action potentials. NaV1.1 channel has been utilized as a therapeutic target for various brain disorders, including epilepsy, Alzheimer's disease, and autisM The NaV1.1 channel also contributes to mechanical pain by regulating the excitability of a specific subset of sensory neurons within the peripheral nervous systeM Several studies, including the analysis of mutations associated with an increase or absence of pain sensitivity in humans, have revealed that Nav1.7, Nav1.8, and Nav1.9 are the most important contributors that control nociceptive neuronal electrogenesis5. JZTX-34 exhibited analgesic activity in three rodent pain models3.

Alomone Labs

hNav1.1 activator, Nav1.7 blocker

An Activator of Nav1.1 channels and Blocker of NaV1.7 Channels

An Activator of Nav1.1 channels and Blocker of NaV1.7 Channels

4150.8 Da

Mu-theraphotoxin-Cg1a, Mu-TRTX-Cg1a, JZTX-34, Peptide F6-25.51

Disulfide bonds between: Cys2-16, Cys9-21 and Cys15-29

C182H258N52O49S6

50 nM - 0.5 µM

JzTx-34 activates hNav1.1, hNav1.3 and hNav1.6. The peptide also blocks hNav1.2, Nav1.5, Nav1.7 and hERG channels, and mildly inhibits hNav1.41. JZTX-34 shows analgesic activity in rodent pain models. In addition, this toxin inhibits voltage-gated potassium channels (Kv) in rat DRG neurons2.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

Lyophilized

Contact Alomone Labs for technical support and product customization

ACREWLGGCSKDADCCAHLECRKKWPYHCVWDWTV-OH

Yes

12352202

yes

no