product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Jingzhaotoxin-34
catalog :
STJ-500
more info or order :
product information
cat :
STJ-500
SKU :
STJ-500_0.1 mg
Product Name :
Jingzhaotoxin-34
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
B1P1F7
Accession Number :
https://www.uniprot.org/uniprotkb/B1P1F7/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys jingzhao)
Source :
Synthetic peptide
Gene ID :
SCN1A,SCN3A, SCN9A
Product Page - Scientific background :
Jingzhaotoxin-34 (JZTX-34) is a 35 amino acid peptidyl toxin, originally isolated from the venom of the Chinese earth tiger tarantula, Chilobrachys guangxiensis1,2.JzTx-34 was reported first as a potent and selective blocker of the voltage-gated sodium (NaV) 1.7 channel and a weak blocker of the Nav1.3 channel3. Recently, it has been found that JzTx-34 has more potent activity as an activator of hNav1.14. In addition, at higher concentrations than hNav1.1, this toxin activated hNav1.3 and hNav1.6 channels and also blocked hNav1.2, hNav1.4, hNav1.5, hNav1.7, and hERG channels4. Moreover, JzTx-34 inhibited voltage-gated potassium (Kv) channels in rat DRG neurons3.Nav channels are transmembrane proteins that control the voltage-dependent increase in sodium permeability. They play a fundamental role in normal neurological function, especially in the initiation and propagation of action potentials. NaV1.1 channel has been utilized as a therapeutic target for various brain disorders, including epilepsy, Alzheimer's disease, and autisM The NaV1.1 channel also contributes to mechanical pain by regulating the excitability of a specific subset of sensory neurons within the peripheral nervous systeM Several studies, including the analysis of mutations associated with an increase or absence of pain sensitivity in humans, have revealed that Nav1.7, Nav1.8, and Nav1.9 are the most important contributors that control nociceptive neuronal electrogenesis5. JZTX-34 exhibited analgesic activity in three rodent pain models3.
Supplier :
Alomone Labs
Target :
hNav1.1 activator, Nav1.7 blocker
Long Description :
An Activator of Nav1.1 channels and Blocker of NaV1.7 Channels
Short Description :
An Activator of Nav1.1 channels and Blocker of NaV1.7 Channels
MW :
4150.8 Da
Synonyms :
Mu-theraphotoxin-Cg1a, Mu-TRTX-Cg1a, JZTX-34, Peptide F6-25.51
Modifications :
Disulfide bonds between: Cys2-16, Cys9-21 and Cys15-29
Molecular formula :
C182H258N52O49S6
Effective Concentration :
50 nM - 0.5 µM
Activity :
JzTx-34 activates hNav1.1, hNav1.3 and hNav1.6. The peptide also blocks hNav1.2, Nav1.5, Nav1.7 and hERG channels, and mildly inhibits hNav1.41. JZTX-34 shows analgesic activity in rodent pain models. In addition, this toxin inhibits voltage-gated potassium channels (Kv) in rat DRG neurons2.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
ACREWLGGCSKDADCCAHLECRKKWPYHCVWDWTV-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments
