chemical

Jingzhaotoxin XI

STJ-400

STJ-400_0.1 mg

Jingzhaotoxin XI

Non Antibodies

Proteins

P0C247

https://www.uniprot.org/uniprotkb/P0C247/entry

Electrophysiology

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys jingzhao)

Synthetic peptide

KCNB1,SCN5A

Jingzhaotoxin XI (JzTx-XI) is a 34-residue peptide toxin originally isolated from the Chinese tarantula Chilobrachys jingzhao venoM Jingzhaotoxin XI toxin can potently inhibit both voltage-gated Na+ channel NaV1.5 with an IC50 value of 124 ± 26 nM and voltage-gated K+ channel KV2.1 with an IC50 value of 390 ± 60 nM1,2,3.The mature toxin contains six cysteine residues linked through disulfide bridges and a hydrophobic patch surrounded by charged residues such as Arg or Lys. Jingzhaotoxin XI is a useful tool for investigating the promiscuity of spider toxins2.JzTx-XI has confirmed activity at ion channels known to be important for pancreatic beta-cell function and insulin signaling, such as the delayed potassium rectifier channel (Kv2.1) and the voltage-gated sodium channel (NaV). The peptide is believed to adopt a characteristic inhibitor cysteine knot (ICK) structure as a result of the six cysteine residues present, which is considered to provide effective resistance against circulating enzymatic breakdown and increase therapeutic utility. JzTx-XI has been shown to increase intracellular calcium influx in beta-cells, although less effectively than Jingzhaotoxin IX (#STJ-300), without directly inducing beta-cell depolarization, as well as protect against cytokine-induced beta-cell apoptosis. Jingzhaotoxin XI has also been shown to augment exenatide-induced appetite suppressive actions and enhance the ability of exenatide to curb appetite in overnight fasted mice4.KV2.1 channels play an important role in neuronal systems including the neural retina. The channel's functions include regulation of neuronal excitability and neural transmitter release5.NaV1.5 channels are important in generating and propagating action potentials in excitable cells, in working myocardium and cardiac tissue conduction cells6.

Alomone Labs

KV2.1 and NaV1.5 channels

A Blocker of NaV1.5 and KV2.1 Channels

A Blocker of NaV1.5 and KV2.1 Channels

3726.3 Da

JzTx-XI, κ-Theraphotoxin-Cg1a 1, κ-TRTX-Cg1a, Jingzhaotoxin-11, JZTX-11, Jingzhaotoxin-XI, JZTX-XI

Disulfide bonds between: Cys2- Cys16, Cys9- Cys21, Cys15- Cys28 Phe34 - C-terminal amidation

C158H234N44O47S7

0.5 - 1 µM

Jingzhaotoxin XI is a blocker of voltage-gated Na+ channel NaV1.5 with an IC50 value of 124 ± 26 nM and voltage-gated K+ channel KV2.1 with an IC50 value of 390 ± 60 nM1.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

Lyophilized

Contact Alomone Labs for technical support and product customization

ECRKMFGGCSVDSDCCAHLGCKPTLKYCAWDGTF-NH2

Yes

12352202

yes

no