product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Jingzhaotoxin-IX
catalog :
STJ-300
more info or order :
image
image 1 :
Alomone Labs STJ-300 image 1
Expression of Synapsin-1 in mouse cerebellum - Immunohistochemical staining of perfusion-fixed frozen mouse brain sections using Anti-Synapsin I (SYN1) Antibody(#ANR-014) (1:400) followed by anti-rabbit-Alexa-488 antibody. Synapsin-1 staining (green) appears in Purkinje cell bodies (horizontal arrows) and in segments of the dendritic tree (vertical arrows). Nuclei are stained with DAPI (blue).
product information
cat :
STJ-300
SKU :
STJ-300_0.1 mg
Product Name :
Jingzhaotoxin-IX
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P0CH44
Accession Number :
https://www.uniprot.org/uniprotkb/P0CH44/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys jingzhao)
Source :
Synthetic peptide
Gene ID :
KCNB1,SCN4A,SCN5A
Product Page - Scientific background :
Jingzhaotoxin-IX (JZTX-IX) is a neurotoxin, C-terminally amidated peptide composed of 35 amino acid residues. JZTX-IX was originally purified from the venom of the tarantula Chilobrachys jingzhao, one of the most venomous spiders in China.Jingzhaotoxin-IX interacts with several types of ion channels, such as NaV channels, tetrodotoxin-resistant and tetrodotoxin-sensitive isoforms and KV2.1 channels.Binding of JZTX-IX toxin to the ion channel can shift the voltage dependence of channel activation to a more positive voltage and is not reversible by extreme depolarization. 10 μM of the toxin is sufficient for a total blockade of the ion channels at resting point without pulsing.JZTX-IX has confirmed activity at ion channels known to be important for pancreatic beta-cell function and insulin signaling, such as the delayed potassium rectifier channel (Kv2.1) and the voltage-gated sodium channel (NaV). The peptide is believed to adopt a characteristic inhibitor cysteine knot (ICK) structure as a result of the six cysteine residues present, which is considered to provide effective resistance against circulating enzymatic breakdown and increase therapeutic utility. JZTX-IX has been shown to significantly increase intracellular calcium influx in beta-cells without directly inducing beta-cell depolarization, as well as increase beta-cell proliferation and protect against cytokine-induced beta-cell apoptosis. Jingzhaotoxin IX has also been shown to augment exenatide-induced appetite suppressive actions and enhance the ability of exenatide to curb appetite in overnight fasted mice2.
Supplier :
Alomone Labs
Target :
NaV1.4, NaV1.5, KV2.1 channels
Long Description :
A Blocker of NaV1.4, NaV1.5 and KV2.1 Channels
Short Description :
A Blocker of NaV1.4, NaV1.5 and KV2.1 Channels
MW :
3953.6 Da
Synonyms :
Jingzhaotoxin-9, JzTx-9, JzTx-IX, Peptide F6-16.24, U18-TRTX-Cg1a, Jingzhaotoxin-32, JZTX-32
Modifications :
Disulfide bonds between: Cys2-Cys16, Cys9-Cys21 and Cys15-Cys29 Phe35 - C-terminal amidation
Molecular formula :
C171H251N49O48S6
Effective Concentration :
0.5 - 1 µM
Activity :
Jingzhaotoxin-IX blocks NaV1.4, NaV1.5 and KV2.1 voltage-gated channels1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
ECTKLLGGCTKDSECCPHLGCRKKWPYHCGWDGTF-NH2
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel