chemical

Jingzhaotoxin-IX

STJ-300

STJ-300_0.1 mg

Jingzhaotoxin-IX

Non Antibodies

Proteins

P0CH44

https://www.uniprot.org/uniprotkb/P0CH44/entry

Electrophysiology

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys jingzhao)

Synthetic peptide

KCNB1,SCN4A,SCN5A

Jingzhaotoxin-IX (JZTX-IX) is a neurotoxin, C-terminally amidated peptide composed of 35 amino acid residues. JZTX-IX was originally purified from the venom of the tarantula Chilobrachys jingzhao, one of the most venomous spiders in China.Jingzhaotoxin-IX interacts with several types of ion channels, such as NaV channels, tetrodotoxin-resistant and tetrodotoxin-sensitive isoforms and KV2.1 channels.Binding of JZTX-IX toxin to the ion channel can shift the voltage dependence of channel activation to a more positive voltage and is not reversible by extreme depolarization. 10 μM of the toxin is sufficient for a total blockade of the ion channels at resting point without pulsing.JZTX-IX has confirmed activity at ion channels known to be important for pancreatic beta-cell function and insulin signaling, such as the delayed potassium rectifier channel (Kv2.1) and the voltage-gated sodium channel (NaV). The peptide is believed to adopt a characteristic inhibitor cysteine knot (ICK) structure as a result of the six cysteine residues present, which is considered to provide effective resistance against circulating enzymatic breakdown and increase therapeutic utility. JZTX-IX has been shown to significantly increase intracellular calcium influx in beta-cells without directly inducing beta-cell depolarization, as well as increase beta-cell proliferation and protect against cytokine-induced beta-cell apoptosis. Jingzhaotoxin IX has also been shown to augment exenatide-induced appetite suppressive actions and enhance the ability of exenatide to curb appetite in overnight fasted mice2.

Alomone Labs

NaV1.4, NaV1.5, KV2.1 channels

A Blocker of NaV1.4, NaV1.5 and KV2.1 Channels

A Blocker of NaV1.4, NaV1.5 and KV2.1 Channels

3953.6 Da

Jingzhaotoxin-9, JzTx-9, JzTx-IX, Peptide F6-16.24, U18-TRTX-Cg1a, Jingzhaotoxin-32, JZTX-32

Disulfide bonds between: Cys2-Cys16, Cys9-Cys21 and Cys15-Cys29 Phe35 - C-terminal amidation

C171H251N49O48S6

0.5 - 1 µM

Jingzhaotoxin-IX blocks NaV1.4, NaV1.5 and KV2.1 voltage-gated channels1.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

Lyophilized

Contact Alomone Labs for technical support and product customization

ECTKLLGGCTKDSECCPHLGCRKKWPYHCGWDGTF-NH2

Yes

12352202

yes

no