product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Jingzhaotoxin-III
catalog :
STJ-200
more info or order :
citations: 2
Reference |
---|
image
image 1 :

Alomone LabsJingzhaotoxin-III inhibits KV2.1 channels heterologously expressed inXenopusoocytes. - A. Time course ofJingzhaotoxin-III(#STJ-200) action on KV2.1 currents. Current amplitude at +40 mV was plotted as a function of time. Membrane potential was held at -80 mV and oocyte were stimulated by a 100 ms voltage ramp to +40 mV. 200 nM Jingzhaotoxin-III (applied for 160 sec green) was perfused during the period marked by the bar as indicated and showed 80% inhibition of control current. B. Superimposed traces of channel current in the absence (black) and presence (green) of 200 nM Jingzhaotoxin-III (taken from experiment in A).
product information
cat :
STJ-200
SKU :
STJ-200_0.1 mg
Product Name :
Jingzhaotoxin-III
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P62520
Accession Number :
https://www.uniprot.org/uniprotkb/P62520/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys jingzhao)
Source :
Synthetic peptide
Gene ID :
KCNB1,SCN5A
Product Page - Scientific background :
Jingzhaotoxin-III (JZTX-III), a peptide toxin isolated from the venom of the Chinese tarantula Chilobrachys Jingzhao, is composed of 36 amino acid residues including 6 cysteines cross-linked in a pattern of I-IV, II-V, and III-VI1.Electrophysiological recordings carried out in Xenopus laevis oocytes show that this toxin acts as a gating modifier of voltage-dependent K+ channels. It slows the rate of KV2.1 channel activation and increases the tail current deactivation, suggesting that toxin-bound channels can still open but are modified. JZTX- III selectively inhibits KV2.1 channels2. JZTX- III blocks KV2.1 currents with an IC50 value of 430 nM in Xenopus oocytes3. It has also been shown to block NaV1.5 with an IC50 value of 0.38 μM in rat cardiac myocytes1.
Supplier :
Alomone Labs
Target :
NaV1.5, KV2.1 channels
Long Description :
A Blocker of KV2.1 and NaV1.5 Channels
Short Description :
A Blocker of KV2.1 and NaV1.5 Channels
MW :
3919.5 Da
Synonyms :
Jingzhaotoxin-3, JZTX-III, β/κ-theraphotoxin-Cg1a, Beta/kappa-theraphotoxin-Cg1a, Beta/kappa-TRTX-Cg1a, Peptide F5-20.38, Jingzhaotoxin III
Modifications :
Disulfide bonds between: Cys4-Cys19, Cys11-Cys24 and Cys18-Cys31
Molecular formula :
C174H241N47O46S6
Effective Concentration :
200 - 500 nM
Activity :
Inhibits NaV1.5 and KV2.1 channels1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
925463-91-8
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
DGECGGFWWKCGRGKPPCCKGYACSKTWGWCAVEAP-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments