product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Jingzhaotoxin-II
catalog :
STJ-150
more info or order :
image
image 1 :
Alomone Labs STJ-150 image 1
Alomone LabsJingzhaotoxin-IIactivates NaV1.5 currents in stably transfected HEK293 cells. - A. Time course ofJingzhaotoxin-II(#STJ-150) action. Current area was plotted as a function of time. Holding potential was -100 mV and currents were stimulated every 20 seconds by a voltage step of 50 msec from holding potential to -20 mV. 500 nM Jingzhaotoxin-II was perfused in the period marked by the horizontal bar (green) indicating a toxin-dependent decrease in NaV1.5 currents inactivation. B. Superimposed traces of NaV1.5 currents before and during 7 min application of 500 nM Jingzhaotoxin-II.
product information
cat :
STJ-150
SKU :
STJ-150_0.1 mg
Product Name :
Jingzhaotoxin-II
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
B1P1B9
Accession Number :
https://www.uniprot.org/uniprotkb/B1P1B9/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys jingzhao)
Source :
Synthetic peptide
Gene ID :
SCN1A,SCN2A,SCN3A,SCN4A,SCN5A,SCN10A,SCN11A
Product Page - Scientific background :
Voltage-gated Na+ channels play a very important role in the upstroke of action potentials, forming the basis for electrical signaling in the nervous system, and control the flow of ions across plasma membrane in response to changes in voltage1. In vertebrates, nine different pore-forming Na+ channels α subunits have been characterized and cloned in cardiac myocytes, neurons, and skeletal muscle. These Na+ channel isoforms are often classified as TTX-sensitive (NaV1.1-1.4, NaV1.6, and NaV1.7) and TTX-resistant (NaV1.5, NaV1.8, and NaV1.9)2.NaV1.5, the major cardiac voltage-gated Na+ channel, plays a central role in the generation of the cardiac action potential and in the propagation of electrical impulses in the heart3.Jingzhaotoxin-II, a 32-residue polypeptide, isolated from the venom of Chinese tarantula Chilobrachys jingzhao. JZTX-II has a high affinity for the tetrodotoxin-resistant (TTX-R) voltage-gated Na+ channels in cardiac myocytes. It significantly slows rapid inactivation with an IC50 value of 260 nM Although JZTX-II does not have an effect on TTX-R neuronal channels in DRG neurons it does affect TTX-sensitive Na+ currents by slowing down their inactivation4.
Supplier :
Alomone Labs
Target :
NaV Na+ Channels
Long Description :
An Activator of NaV Channels
Short Description :
An Activator of NaV Channels
MW :
3561 Da
Synonyms :
U7-theraphotoxin Cg1a, JZTX-2, Peptide F2-32.19
Modifications :
Disulfide bonds between: Cys2-Cys16, Cys9-Cys21, Cys15-Cys28
Molecular formula :
C154H219N39O45S7
Effective Concentration :
200 - 500 nM
Activity :
Jingzhaotoxin-II significantly slows rapid inactivation of TTX-resistant VGSC in cardiac myocytes and TTX-sensitive Na+ channels1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
GCGTMWSPCSTEKPCCDNFSCQPAIKWCIWSP-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel