Jingzhaotoxin-XII | Alomone Labs STJ-100 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

Jingzhaotoxin-XII

catalog :

STJ-100

more info or order :

Alomone Labs product webpage

image

image 1 :

Alomone LabsJingzhaotoxin-XIIinhibits KV4.1 currents in transiently transfected HEK293T cells. - A. Time course ofJingzhaotoxin-XII(#STJ-100) action. Peak current amplitude was plotted as a function of time. Holding potential was -100 mV and currents were stimulated every 20 seconds by a voltage step of 80 msec from holding potential to 0 mV. 2 M Jingzhaotoxin-XII was perfused in the period marked by the horizontal bar (green) indicating the inhibitory effect of Jingzhaotoxin-XII. B. Superimposed traces of KV4.1 currents under control conditions and after 3 min application of 2 M Jingzhaotoxin-XII (green as indicated).

image 2 :

Alomone Labs Alosetron blocks 5-HT3A receptors expressed in HEK 293T cells. - 5-HT3A receptor currents were elicited with 10 M 5-HT delivered every 3 minutes. Alosetron (#A-235) was applied 30 seconds before stimulation at 1 10 and 100 nM as indicated and completely inhibited the 5-HT induced current in a dose-dependent and reversible manner.

product information

cat :

STJ-100

SKU :

STJ-100_0.1 mg

Product Name :

Jingzhaotoxin-XII

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P0C5X7

Accession Number :

https://www.uniprot.org/uniprotkb/P0C5X7/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys jingzhao)

Source :

Synthetic peptide

Gene ID :

KCNB1,KCND1,KCND2,SCN5A

Product Page - Scientific background :

Voltage-gated K+ (KV) channels play important roles in regulating the excitability of myocytes and neurons. KV channel α subunits are divided into four major subfamilies, KV1 through KV41. The KV4 (Shal) subfamily comprises three distinct genes, KV4.1, KV4.2, and KV4.32.Voltage-gated Na+ channels play an important role in generating action potentials. NaV channels consists nine different α subunits, NaV1.1 through NaV1.93.Jingzhaotoxin-XII (JZTX-XII), a 29-residue polypeptide, isolated from the venom of Chinese tarantula Chilobrachys jingzhao. JZTX-XII is specific for the Kv4.1 channel and has high selectivity to the NaV channel isoform expressed in cardiac myocytes. It interacts with the channels by modifying the gating behavior4. JZTX-XII blocks KV4.1 currents with an IC50 value of 363 nM in X. laevis oocytes5 and can inhibit NaV1.5 with an IC50 value of 348 nM6.

Supplier :

Alomone Labs

Target :

KV4.1, NaV1.5 channels

Long Description :

A Blocker of KV4.1 and NaV1.5 Voltage-Gated Channels

Short Description :

A Blocker of KV4.1 and NaV1.5 Voltage-Gated Channels

MW :

3665.3 Da

Synonyms :

Kappa-theraphotoxin-Cg2a, Kappa-TRTX-Cg2a, Jingzhaotoxin-12, JZTX-12, JZTX-XII, Jingzhaotoxin-45, JZTX-45, Peptide F4-20.99

Modifications :

Disulfide bonds between: Cys2-Cys16, Cys9-Cys21, Cys15-Cys25 Leu29 - C-terminal amidation

Molecular formula :

C161H227N41O44S7

Effective Concentration :

200 nM - 2 µM

Activity :

Jingzhaotoxin-XII inhibits KV4.1 and NaV1.5 voltage-gated channels1,2.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

YCQKWMWTCDSERKCCEGYVCELWCKYNL-NH2

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage