Jingzhaotoxin-V | Alomone Labs STJ-050 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

Jingzhaotoxin-V

catalog :

STJ-050

more info or order :

Alomone Labs product webpage

image

image 1 :

Alomone Labs Jingzhaotoxin-Vinhibits NaV1.7 channels heterologously expressed in HEK293 cells. - NaV1.7 currents were elicited by 30 ms voltage ramp from the holding potential of -100 mV to +60 mV applied every 10 sec using whole-cell voltage clamp technique. A. Time course of NaV1.7 current amplitude changes before (black) and during (green) application of 10 nMJingzhaotoxin-V(#STJ-050) indicated by the horizontal bar. B. Superimposed example current traces of NaV1.7 currents before (black) and during (green) 200 sec application of 10 nM Jingzhaotoxin-V as indicated.

product information

cat :

STJ-050

SKU :

STJ-050_0.1 mg

Product Name :

Jingzhaotoxin-V

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

Q2PAY4

Accession Number :

https://www.uniprot.org/uniprotkb/Q2PAY4/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys jingzhao)

Source :

Synthetic peptide

Gene ID :

KCND2,KCND3,SCN10A,SCN11A,SCN3A,SCN4A,SCN5A,SCN9A

Product Page - Scientific background :

Jingzhaotoxin-V is a 29 amino acid peptidyl toxin isolated from the Chilobrachys jingzhao (Chinese earth tiger tarantula) spider1. It significantly inhibits tetrodotoxin-resistant (TTX-R) and tetrodotoxin-sensitive (TTX-S) Na+ channels in adult rat DRG neurons as well as KV4.2 K+ channels expressed in Xenopus laevis oocytes1.It was found that Jingzhaotoxin-V alters the gating properties of Na+ channels by shifting the activation curves to the depolarizing direction and the inactivation curves to the hyperpolarizing direction1. The findings related to this peptide further reinforced the viewpoint that gating-modifier toxins can alter the voltage-dependent gating through the lipid membrane partitioning1.

Supplier :

Alomone Labs

Target :

NaV channels, KV4.2, KV4.3 channels

Long Description :

A Potent Inhibitor of NaV Channels and KV4.2 and KV4.3 Channels

Short Description :

A Potent Inhibitor of NaV Channels and KV4.2 and KV4.3 Channels

MW :

3605.4 Da

Synonyms :

JzTx-V, β/κ-Theraphotoxin-Cg2a, β/κ-TRTX-Cg2a, Peptide F8-15.73, Beta-theraphotoxin-Cj2a

Modifications :

Disulfide bonds between: Cys2-Cys16, Cys9-Cys21, Cys15-Cys25 Ile29 - C-terminal amidation

Molecular formula :

C157H243N47O37S7

Effective Concentration :

5 - 10 nM

Activity :

Jingzhaotoxin-V inhibits TTX-resistant and TTX-sensitive Na+ channels in DRG neurons. It also highly inhibits KV4.2 and KV4.3 K+ channels and weakly inhibits KV2.1 K+ channels. It has no effect on KV1.2, KV1.3 or KV1.4 K+ channels1,2.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

YCQKWMWTCDSKRACCEGLRCKLWCRKII-NH2

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage