product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Iberiotoxin
catalog :
STI-400
more info or order :
citations: 59
| Reference |
|---|
Krishnamoorthy G, Reimann K, Wangemann P. Ryanodine-induced vasoconstriction of the gerbil spiral modiolar artery depends on the Ca2+ sensitivity but not on Ca2+ sparks or BK channels. BMC Physiol. 2016;16:6 pubmed
|
image
image 1 :

Alomone Labs Iberiotoxin inhibits KCa1.1 channels (mSlo)heterologously expressed inXenopusoocytes. - A. Time course of KCa1.1 channel current amplitude before (black) during (green marked by horizontal bar) application of 100 nMIberiotoxin(#STI-400) for 200 sec and upon wash of the toxin. Currents were elicited every 10 sec by ramp stimulation to +100 mV from a holding of ?100 mV for 100 msec. B. Superimposed example current responses before (black) and during (green) application of 100 nM Iberiotoxin (taken from the experiment in A).
image 2 :

Alomone Labs Alosetron hydrochloride blocks 5HT3A receptors expressed in HEK 293T cells. - 5-HT3A receptor currents were elicited with 10 M 5-HT delivered every 3 minutes. Alosetron hydrochloride (#A-236) was applied 30 seconds before stimulation at 1 10 and 100 nM as indicated and completely inhibited the 5-HT induced current in a dose-dependent and reversible manner.
product information
cat :
STI-400
SKU :
STI-400_0.1 mg
Product Name :
Iberiotoxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P24663
Accession Number :
https://www.uniprot.org/uniprotkb/P24663/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Hottentotta tamulus (Eastern Indian scorpion) (Mesobuthus tamulus)
Source :
Synthetic peptide
Gene ID :
KCNMA1
Product Page - Scientific background :
Iberiotoxin is a 37 amino acid peptidyl toxin isolated from the scorpion Mesobuthus tamulus and was shown to block large conductance Ca2+-activated K+ channels in smooth muscle cells1. Later it was shown to specifically block KCa1.1 (Slo) channels with Ki of about 1 nM2. In addition, experiments with cloned KCa1.1 channels demonstrate the strong effect of the sloβ subunits on the potency of block by Iberiotoxin3.
Supplier :
Alomone Labs
Target :
KCa1.1 K+ channels
Long Description :
A Potent and Specific Blocker of KCa1.1 K+ Channels
Short Description :
A Potent and Specific Blocker of KCa1.1 K+ Channels
MW :
4230.8 Da
Synonyms :
K+ channel toxin α-KTx 1.3, IbTx
Modifications :
Disulfide bonds between: Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35 Z = Pyrrolidone carboxylic acid
Molecular formula :
C179H274N50O55S7
Effective Concentration :
50 - 100 nM
Activity :
Iberiotoxin is a potent selective blocker of the high conductance Ca2+-activated K+ channels (maxi-K).
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
129203-60-7
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
ZFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
Cited Application :
Electrophysiology
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
related products
browse more products
questions and comments
