product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
ɩ-Conotoxin RXIA
catalog :
STI-300
more info or order :
image
image 1 :

ManufacturerBioassayAlomone Labs Iota-Conotoxin RXIA affects the activation of NaV1.6 channels expressed in Xenopus oocytes. - A. Representative traces of NaV1.6 channel currents before (black) and after the application of 1 µM (magenta) and 10 µM (green) Iota-Conotoxin RXIA (#STI-300). Iota-Conotoxin RXIA caused a significant current at a voltage that does not normally activates the channel. Membrane potential was held at -100 mV, and a voltage step to -20 mV was applied every 10 sec. B. Representative time course of current amplitude at -20 mV before, during application of 1 µM and 10 µM Iota-Conotoxin RXIA (as indicated by bars) and upon wash, demonstrating the current amplitude enhancement.
product information
cat :
STI-300
SKU :
STI-300_0.1 mg
Product Name :
ɩ-Conotoxin RXIA
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
Q7Z094
Accession Number :
https://www.uniprot.org/uniprotkb/Q7Z094/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Conus radiatus (Rayed cone)
Source :
Synthetic peptide
Gene ID :
SCN2A,SCN8A,SCN9A
Product Page - Scientific background :
Iota-conotoxin RXIA (É©-Conotoxin RXIA), a peptide toxin originally isolated from Conus radiatus, is a voltage-gated sodium channel activator. The peptide toxin belongs to of the I1-superfamily, which contains eight cysteine residues arranged in a -C-C-CC-CC-C-C- pattern. Iota-RXIA is one of three characterized I1 peptides in which the third to last residue is posttranslationally isomerized to the d configuration. Naturally occurring Iota-conotoxin RXIA with d-Phe44 is significantly more active as an excitotoxin than the l-Phe analogue both in vitro and in vivo although crystallography data has shown the overall structure is only slightly altered by this shift1.Iota-conotoxin RXIA affects NaV1.6, Nav1.2 and Nav1.7 sodium channels by shifting their voltage dependence of activation to more hyperpolarized potentials2.NaV channel agonists have been isolated from the venom of different organisms and are also produced by plants, bacteria and algae. These compounds provide key insights into the molecular structure, function and pathophysiological roles of NaV channels and are important tools due to their specific subtype-selectivity1.
Supplier :
Alomone Labs
Target :
Nav1.6, Nav1.2 and Nav1.7 channels
Long Description :
An Activator of NaV1.6, NaV1.2 and NaV1.7 Channels
Short Description :
An Activator of NaV1.6, NaV1.2 and NaV1.7 Channels
MW :
4975.6 Da
Synonyms :
Iota-conotoxin RXIA, R11.6, r11a
Modifications :
Disulfide bonds between: Cys5-Cys19, Cys12-Cys22, Cys18-Cys27, Cys21-Cys38 P2, P11, P29 - Hydroxylation D-Phenylalanine44 - D-amino acid
Molecular formula :
C212H310N54O69S8
Effective Concentration :
1 - 10 µM
Activity :
Iota-conotoxin RXIA activates NaV1.2, NaV1.6, and NaV1.7 by shifting the voltage-dependence of activation to more hyperpolarized levels1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
GPSFCKADEKPCEYHADCCNCCLSGICAPSTNWILPGCS
TSSFFKI-OH
TSSFFKI-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments