product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Hj2a Toxin
catalog :
STH-555
more info or order :
product information
cat :
STH-555
SKU :
STH-555_0.1 mg
Product Name :
Hj2a Toxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P0DQN9
Accession Number :
https://www.uniprot.org/uniprotkb/P0DQN9/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Hottentotta judaicus (Black scorpion) (Buthotus judaicus)
Source :
Synthetic protein
Gene ID :
SCN1A,SCN4A,SCN5A,SCN8A,SCN9A
Product Page - Scientific background :
δ-buthitoxin-Hj2a (Hj2a) is a peptidyl toxin originally isolated from the venom of the scorpion, Hottentotta jayakari. Hj2a acts as a voltage-gated sodium (Nav) 1.1 channel activator, but it also harbors promiscuous activity towards multiple human NaV channel subtypes. Hj2a is unique in that it exhibits a dual α/β mode of action by modifying both the inactivation (α-toxin activity) and activation (β-toxin activity) properties of the NaV1.1 channel1.NaV channels are involved in a wide array of physiological processes and play a fundamental role in normal neurological function, especially in the initiation and propagation of action potentials. In particular, the NaV1.1 channel is predominantly expressed in inhibitory interneurons of the brain and it plays a major role in regulating brain rhythms and cognitive functions. Mutations in the NaV1.1 channel were shown to be associated with Dravet syndrome (DS), a severe form of pediatric epilepsy. Selective modulators of the NaV1.1 channel can be useful therapeutics for DS treatment since they target the underlying molecular deficit. The unusual dual mode of action of Hj2a provides an alternative approach for the development of selective NaV1.1 channel modulators for the treatment of DS1,2.
Supplier :
Alomone Labs
Target :
NaV1.1, Voltage-gated Na+ channels
Long Description :
A Potent Activator of Nav1.1, Nav1.4, Nav1.5, Nav1.6 and Nav1.7 Channels.
Short Description :
A Potent Activator of Nav1.1, Nav1.4, Nav1.5, Nav1.6 and Nav1.7 Channels.
MW :
7118 Da
Synonyms :
Delta-buthitoxin-Hj2a, Delta-BUTX-Hj2a
Modifications :
Disulfide bonds between: Cys12-Cys63, Cys16-Cys36, Cys22-Cys46 and Cys26-Cys48 Arg64 - C-terminal amidation
Molecular formula :
C304H458N90O93S8
Effective Concentration :
20 - 500 nM
Activity :
Hj2a is an agonist of NaV1.1 which presents dual α/β activity by modifying both the activation and inactivation properties of the channel1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
GRDAYIADDKNCVYTCAKNSYCNNECTKNGAESGYCQWL
GKYGNGCWCKNLPDKVPIRIPGPCR-NH2
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel