product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Hj1a Toxin
catalog :
STH-450
more info or order :
product information
cat :
STH-450
SKU :
STH-450_0.1 mg
Product Name :
Hj1a Toxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P0DQN8
Accession Number :
https://www.uniprot.org/uniprotkb/P0DQN8/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Hottentotta judaicus (Black scorpion) (Buthotus judaicus)
Source :
Synthetic protein
Gene ID :
SCN1A,SCN4A,SCN5A,SCN8A
Product Page - Scientific background :
Hj1a is a peptide toxin originally isolated from the Hottentotta jayakari scorpion venoM Hj1a acts as a potent NaV1.1 channel activator. Hj1a is unique in that it presents a dual α/β activity by modifying both the activation and inactivation properties of the channel1.NaV1.1 is predominantly expressed in inhibitory interneurons of the brain and it plays a major role in regulating brain rhythms and cognitive functions. Mutations in NaV1.1 channel were shown to be related to Dravet syndrome (DS), a severe form of pediatric epilepsy. NaV1.1 selective modulators can be useful therapeutics for treatment of DS as they target the underlying molecular deficit2.
Supplier :
Alomone Labs
Target :
Nav1.1 channels
Long Description :
An Activator of NaV1.1 Channel
Short Description :
An Activator of NaV1.1 Channel
MW :
7482.5 Da
Synonyms :
δ-buthitoxin-Hj1a, Delta-buthitoxin-Hj1a
Modifications :
Disulfide bonds between: Cys14-Cys65, Cys18-Cys38, Cys24-Cys48 and Cys28-Cys50
Molecular formula :
C326H482N92O96S8
Effective Concentration :
1 µM
Activity :
Hj1a Toxin is an activator of NaV1.1 which presents dual α/β activity by modifying both the activation and inactivation properties of the channel1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
>95% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
EEVRDAYIAQPHNCVYHCFRDSYCNDLCIKHGAESGECK
WFTSSGNACWCVKLPKSEPIKVPGKCH-OH
WFTSSGNACWCVKLPKSEPIKVPGKCH-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments