chemical

Hj1a Toxin

STH-450

STH-450_0.1 mg

Hj1a Toxin

Non Antibodies

Proteins

P0DQN8

https://www.uniprot.org/uniprotkb/P0DQN8/entry

Electrophysiology

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Hottentotta judaicus (Black scorpion) (Buthotus judaicus)

Synthetic protein

SCN1A,SCN4A,SCN5A,SCN8A

Hj1a is a peptide toxin originally isolated from the Hottentotta jayakari scorpion venoM Hj1a acts as a potent NaV1.1 channel activator. Hj1a is unique in that it presents a dual α/β activity by modifying both the activation and inactivation properties of the channel1.NaV1.1 is predominantly expressed in inhibitory interneurons of the brain and it plays a major role in regulating brain rhythms and cognitive functions. Mutations in NaV1.1 channel were shown to be related to Dravet syndrome (DS), a severe form of pediatric epilepsy. NaV1.1 selective modulators can be useful therapeutics for treatment of DS as they target the underlying molecular deficit2.

Alomone Labs

Nav1.1 channels

An Activator of NaV1.1 Channel

An Activator of NaV1.1 Channel

7482.5 Da

δ-buthitoxin-Hj1a, Delta-buthitoxin-Hj1a

Disulfide bonds between: Cys14-Cys65, Cys18-Cys38, Cys24-Cys48 and Cys28-Cys50

C326H482N92O96S8

1 µM

Hj1a Toxin is an activator of NaV1.1 which presents dual α/β activity by modifying both the activation and inactivation properties of the channel1.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

>95% (HPLC)

Lyophilized

Contact Alomone Labs for technical support and product customization

EEVRDAYIAQPHNCVYHCFRDSYCNDLCIKHGAESGECK
WFTSSGNACWCVKLPKSEPIKVPGKCH-OH

Yes

12352202

yes

no