chemical

Hongotoxin-1

STH-400

STH-400_0.1 mg

Hongotoxin-1

Non Antibodies

Proteins

P59847

https://www.uniprot.org/uniprotkb/P59847/entry

Electrophysiology

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Centruroides limbatus (Bark scorpion)

Synthetic peptide

KCNA1 ,KCNA2 ,KCNA3

Hongotoxin is a peptide toxin originally isolated from the scorpion Centruroides limbatus1 and was shown to block cloned and heterologously expressed (in HEK 293 cells) KV1.1, KV1.2 and KV1.3 with IC50 of 31, 170 and 86 pM respectively1. In addition, it blocks KV1.6 with lower affinity (IC50 = 6 nM).Hongotoxin-1 action was examined by monitoring radiolabeled Rb+ efflux from KV channels-transfected HEK 293 cells. Hongotoxin-1 blocks 125I-Margtoxin (Margatoxin) binding to rat brain synaptosomes1 or 125I-Kaliotoxin binding to purified KV1.3-KcsA chimeras2. A mutated 125I-Hongotoxin-1 was used to immunoprecipitate (with specific KV antibodies) rat brain KV channels and to determine their subunit composition1.

Alomone Labs

KV1.1, KV1.2, KV1.3 K+ channels

A Potent Blocker of Some KV1 K+ Channels

A Potent Blocker of Some KV1 K+ Channels

4220 Da

K+ channel toxin α-KTx 2.5, HgTX1

Disulfide bonds between: Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36

C181H293N53O49S7

0.1 - 0.2 pM

Hongotoxin-1 is a potent selective inhibitor of KV1.1, KV1.2 and KV1.3 voltage-gated K+ channels and a weak inhibitor of KV1.6 K+ channel. Hongotoxin does not block KV1.4 nor KV1.5 currents1.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

203526-59-4

Lyophilized

Contact Alomone Labs for technical support and product customization

TVIDVKCTSPKQCLPPCKAQFGIRAGAKCMNGKCKCYPH-OH

Yes

12352202

yes

no