product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Heteropodatoxin-2
catalog :
STH-340
more info or order :
citations: 4
| Reference |
|---|
image
image 1 :

Alomone Labs Heteropodatoxin-2 inhibits KV4.2 channel currents expressed inXenopusoocytes. - Currents were elicited by application of voltage step from a holding potential of -100 mV to 0 mV in 100 msec delivered every 10 seconds. A. Time course of channel activity (current amplitude at +0 mV) before (black) and during (green) application of 100 nMHeteropodatoxin-2(#STH-340). B. Example of superimposed current traces before (black) and during (green) application of 100 nM Heteropodatoxin-2 taken from the experiment in A.
product information
cat :
STH-340
SKU :
STH-340_0.1 mg
Product Name :
Heteropodatoxin-2
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P58426
Accession Number :
https://www.uniprot.org/uniprotkb/P58426/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Heteropoda venatoria (Brown huntsman spider) (Aranea venatoria)
Source :
Synthetic peptide
Gene ID :
KCND2, KCND3, KCND1
Product Page - Scientific background :
Heteropodatoxin-2 is a synthetic peptide purified to homogeneity, originally isolated from the Heteropoda venatoria spider venom1,2. Heteropodatoxin-2 is an inhibitor of voltage-gated K+ channels of the KV4 family. Inhibition of KV4.3 and KV4.2 is strongly voltage-dependent, while inhibition of KV4.1 shows less voltage-dependence. Heteropodatoxin-2 lacks affinity for KV1.4, KV2.1 and KV3.41,3. It also blocks Ca2+ channels1.
Supplier :
Alomone Labs
Target :
KV4 K+ channels
Long Description :
A Potent Blocker of KV4 K+ Channels
Short Description :
A Potent Blocker of KV4 K+ Channels
MW :
3413 Da
Synonyms :
κ-Sparatoxin-Hv1b, κ-SPRTX-Hv1b, Toxin KJ6, HpTX2
Modifications :
Disulfide bonds between: Cys3-Cys17, Cys10-Cys22, and Cys16-Cys26 Trp30 - C-terminal amidation
Molecular formula :
C144H207N39O46S6
Effective Concentration :
100 - 500 nM
Activity :
Heteropodatoxin-2 is an inhibitor of voltage-gated K+ channels of the KV4 family. Inhibition of KV4.3 and KV4.2 is strongly voltage-dependent, while inhibition of KV4.1 shows less voltage-dependence. Lacks affinity for KV1.4, KV2.1 and KV3.41,2. Also blocks Ca2+ channels1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
DDCGKLFSGCDTNADCCEGYVCRLWCKLDW-NH2
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments
