Heteropodatoxin-2 | Alomone Labs STH-340 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

Heteropodatoxin-2

catalog :

STH-340

more info or order :

Alomone Labs product webpage

citations: 4

Reference
Sandler M, Shulman Y, Schiller J. A Novel Form of Local Plasticity in Tuft Dendrites of Neocortical Somatosensory Layer 5 Pyramidal Neurons. Neuron. 2016;90:1028-42 pubmed publisher
Subramaniam M, Althof D, Gispert S, Schwenk J, Auburger G, Kulik A, et al. Mutant Î±-synuclein enhances firing frequencies in dopamine substantia nigra neurons by oxidative impairment of A-type potassium channels. J Neurosci. 2014;34:13586-99 pubmed publisher
Min M, Wu Y, Shih P, Lu H, Wu Y, Hsu C, et al. Roles of A-type potassium currents in tuning spike frequency and integrating synaptic transmission in noradrenergic neurons of the A7 catecholamine cell group in rats. Neuroscience. 2010;168:633-45 pubmed publisher
Norris A, Nerbonne J. Molecular dissection of I(A) in cortical pyramidal neurons reveals three distinct components encoded by Kv4.2, Kv4.3, and Kv1.4 alpha-subunits. J Neurosci. 2010;30:5092-101 pubmed publisher

image

image 1 :

Alomone Labs Heteropodatoxin-2 inhibits KV4.2 channel currents expressed inXenopusoocytes. - Currents were elicited by application of voltage step from a holding potential of -100 mV to 0 mV in 100 msec delivered every 10 seconds. A. Time course of channel activity (current amplitude at +0 mV) before (black) and during (green) application of 100 nMHeteropodatoxin-2(#STH-340). B. Example of superimposed current traces before (black) and during (green) application of 100 nM Heteropodatoxin-2 taken from the experiment in A.

product information

cat :

STH-340

SKU :

STH-340_0.1 mg

Product Name :

Heteropodatoxin-2

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P58426

Accession Number :

https://www.uniprot.org/uniprotkb/P58426/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Heteropoda venatoria (Brown huntsman spider) (Aranea venatoria)

Source :

Synthetic peptide

Gene ID :

KCND2, KCND3, KCND1

Product Page - Scientific background :

Heteropodatoxin-2 is a synthetic peptide purified to homogeneity, originally isolated from the Heteropoda venatoria spider venom1,2. Heteropodatoxin-2 is an inhibitor of voltage-gated K+ channels of the KV4 family. Inhibition of KV4.3 and KV4.2 is strongly voltage-dependent, while inhibition of KV4.1 shows less voltage-dependence. Heteropodatoxin-2 lacks affinity for KV1.4, KV2.1 and KV3.41,3. It also blocks Ca2+ channels1.

Supplier :

Alomone Labs

Target :

KV4 K+ channels

Long Description :

A Potent Blocker of KV4 K+ Channels

Short Description :

A Potent Blocker of KV4 K+ Channels

MW :

3413 Da

Synonyms :

κ-Sparatoxin-Hv1b, κ-SPRTX-Hv1b, Toxin KJ6, HpTX2

Modifications :

Disulfide bonds between: Cys3-Cys17, Cys10-Cys22, and Cys16-Cys26 Trp30 - C-terminal amidation

Molecular formula :

C144H207N39O46S6

Effective Concentration :

100 - 500 nM

Activity :

Heteropodatoxin-2 is an inhibitor of voltage-gated K+ channels of the KV4 family. Inhibition of KV4.3 and KV4.2 is strongly voltage-dependent, while inhibition of KV4.1 shows less voltage-dependence. Lacks affinity for KV1.4, KV2.1 and KV3.41,2. Also blocks Ca2+ channels1.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

DDCGKLFSGCDTNADCCEGYVCRLWCKLDW-NH2

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage