chemical

Hm3a Toxin

STH-250

STH-250_0.1 mg

Hm3a Toxin

Non Antibodies

Proteins

C0HKD0

https://www.uniprot.org/uniprotkb/C0HKD0/entry

Electrophysiology

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Heteroscodra maculata (Togo starburst tarantula) (Togo starburst baboon spider)

Synthetic peptide

ASIC1a,ASIC1b

Hm3a is a 37-amino acid peptide toxin originally isolated from the venom of Togo starburst tarantula (Heteroscodra maculata) and acts as a potent ASIC1a channel blocker with an IC50 value of 1-2 nM and ASIC1b channel activator with an EC50 value of 46.5 nM1. Studies reveal that Glu177 and Arg175 in the palm region opposite α-helix 5 play an important role in the interaction between Hm3a and ASIC1 and contribute to the subtype-dependent effects of the peptide. Hm3a is a useful tool for studying ASICs1.Acid-sensing ion channels (ASICs) are voltage-independent proton-gated amiloride sensitive sodium channels, belonging to the DEG/ENaC gene family, activated by a drop in extracellular pH. ASIC1a is a promising therapeutic target1,2.

Alomone Labs

ASIC1a and ASIC1b

A Highly Potent ASIC1a Blocker and ASIC1b Activator

A Highly Potent ASIC1a Blocker and ASIC1b Activator

4287 Da

Pi-theraphotoxin-Hm3a, Pi-TRTX-Hm3a

Disulfide bonds between Cys3- Cys18, Cys10- Cys23, Cys17- Cys33

C186H290N56O49S6

1 - 200 nM

Hm3a Toxin acts as a potent ASIC1a channel blocker with an IC50 value of 1-2 nM and ASIC1b channel activator with an EC50 value of 46.5 nM1.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

Lyophilized

Contact Alomone Labs for technical support and product customization

EPCIPKWKSCVNRHGDCCAGLECWKRRKSFEVCVPKV-OH

Yes

12352202

yes

no