product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Hd1a Toxin
catalog :
STH-200
more info or order :
image
image 1 :

Alomone LabsTrifluoperazine dihydrochlorideblocks KV4. 3 channels expressed inXenopusoocytes. - A. Time course of KV4.3 current amplitude and inhibition by 100 and 300 MTrifluoperazine dihydrochloride(#T-175). Currents were elicited by application of voltage step from a holding potential of -80 mV to 0 mV (150 msec) every 10 seconds. B. Superimposed example traces of current responses before and during perfusion of 100 and 300 M Trifluoperazine dihydrochloride as indicated.
product information
cat :
STH-200
SKU :
STH-200_0.1 mg
Product Name :
Hd1a Toxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
A0A0J9X1W9
Accession Number :
https://www.uniprot.org/uniprotkb/A0A0J9X1W9/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Cyriopagopus doriae (Tarantula spider) (Haplopelma doriae)
Source :
Synthetic peptide
Gene ID :
SCN1A,SCN9A
Product Page - Scientific background :
Hd1a Toxin, also called µ-TRTX-Hd1a, is a peptide toxin that acts as a selective and potent blocker of voltage-gated NaV1.7 channels.The Hd1a peptide is a member of the NaSpTx family 1 of spider venoms, originating from the Haplopelma doriae spider. The toxin inhibits human NaV1.7 by interacting with the S3b-S4 paddle motif in channel domain II. Hd1a structure contains an inhibitor cystine knot motif that is likely to confer high levels of chemical, thermal and biological stability1.Human NaV1.7 shows properties as an analgesic target. Loss-of-function mutations in the SNC9A gene that encodes human NaV1.7 result in congenital indifference to all forms of pain. Thus, inhibitors of hNaV1.7 including Hd1a Toxin are likely to be useful analgesics for treating a range of pain conditions1,2.
Supplier :
Alomone Labs
Target :
NaV1.7 channel
Long Description :
A Selective Blocker of NaV1.7 Channels
Short Description :
A Selective Blocker of NaV1.7 Channels
MW :
3822.4 Da
Synonyms :
µ-TRTX-Hd1a
Modifications :
Disulfide bonds between: Cys2-Cys17, Cys9-Cys24, and Cys16-Cys31
Molecular formula :
C160H246N46O51S6
Effective Concentration :
500 nM - 1 µM
Activity :
Hd1a is a selective and potent blocker of voltage-gated NaV1.7 channels1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
ACLGFGKSCNPSNDQCCKSSSLACSTKHKWCKYEL-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments