Hainantoxin-IV | Alomone Labs STH-130 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

Hainantoxin-IV

catalog :

STH-130

more info or order :

Alomone Labs product webpage

image

image 1 :

Alomone Labs Hainantoxin-IV inhibits NaV1. 2 currents heterologously expressed inXenopusoocytes. - A. Time course ofHainantoxin-IV(#STH-130) action on NaV1.2 currents. Maximum current amplitudes were plotted as a function of time. Membrane potential was held at -100 mV and cells were stimulated by a 100 ms voltage ramp to -10 mV. 50 nM (green) and 250 nM (red) Hainantoxin-IV were perfused as indicated by the bars during 360 sec and 260 sec respectively. B. Superimposed NaV1.2 channel current traces in the absence and presence of 50 nM (green) or 250 nM (red) Hainantoxin-IV (taken from the experiment in A).

image 2 :

product information

cat :

STH-130

SKU :

STH-130_0.1 mg

Product Name :

Hainantoxin-IV

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

D2Y232

Accession Number :

https://www.uniprot.org/uniprotkb/D2Y232/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum)

Source :

Synthetic peptide

Gene ID :

SCN1A,SCN2A,SCN3A,SCN4A,SCN8A,SCN9A

Product Page - Scientific background :

Hainantoxin-IV (HNTX-IV) is a 35-amino acid peptidyl toxin originally isolated from the venom of the Chinese bird spider Ornithoctonus hainana Liang (Selenocosmia hainana Liang). HNTX-IV is a potent and selective inhibitor of TTX-sensitive NaV channels1. It has been shown to specifically inhibit the neuronal TTX-S VGSCs with an IC50 of 34 nM in adult rat dorsal root ganglion (DRG) neurons. HNTX-IV blocks neuromuscular transmission in the isolated nerve-synapse preparations of rat. HNTX-IV seems to interact with neurotoxin receptor site 1 through a mechanism quite similar to that of TTX without affecting the activation and inactivation kinetics. The toxin has six cysteine residues that form three disulfide bonds are clustered together in small peptides2.

Supplier :

Alomone Labs

Target :

TTX-sensitive NaV channels

Long Description :

A Blocker of TTX-Sensitive NaV Channels

Short Description :

A Blocker of TTX-Sensitive NaV Channels

MW :

3987.6 Da

Synonyms :

μ-theraphotoxin-Hhn1b, μ-TRTX-Hhn1b, Hainantoxin-4, HnTx-IV, Peptide F8-18.88

Modifications :

Disulfide bonds between: Cys2-Cys17, Cys9-Cys24, and Cys16-Cys31 Ile35 - C-terminal amidation

Molecular formula :

C166H257N53O50S6

Effective Concentration :

20 - 250 nM

Activity :

Neural TTX-sensitive voltage-gated Na+ channel inhibitor1,2.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

ECLGFGKGCNPSNDQCCKSSNLVCSRKHRWCKYEI-NH2

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage