Hainantoxin-III | Alomone Labs STH-120 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

Hainantoxin-III

catalog :

STH-120

more info or order :

Alomone Labs product webpage

citations: 1

Reference
Slowik D, Henderson R. Benchmarking the stability of human detergent-solubilised voltage-gated sodium channels for structural studies using eel as a reference. Biochim Biophys Acta. 2015;1848:1545-51 pubmed publisher

image

image 1 :

Alomone LabsHainantoxin-III inhibits NaV1.7 channels heterologously expressed in HEK293 cells. - NaV1.7 currents were elicited by 30 ms voltage ramp from the holding potential of -100 mV to +60 mV applied every 10 sec using whole-cell voltage clamp technique. A. Time course of NaV1.7 current amplitude changes before (black) and during (green) application of 0.5 MHainantoxin-III(#STH-120) indicated by the horizontal bar. B. Superimposed example current traces of NaV1.7 currents before (black) and during (green) 200 sec application of 0.5 M Hainantoxin-III as indicated.

image 2 :

product information

cat :

STH-120

SKU :

STH-120_0.1 mg

Product Name :

Hainantoxin-III

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

D2Y1Y1

Accession Number :

https://www.uniprot.org/uniprotkb/D2Y1Y1/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum)

Source :

Synthetic peptide

Gene ID :

SCN1A,SCN2A,SCN3A,SCN9A

Product Page - Scientific background :

Hainantoxin-III is a 33 amino acid peptidyl toxin isolated from the Haplopelma hainanum (Selenocosmia hainana, Chinese bird) tarantula spider1.Hainantoxin-III strongly depresses the amplitude of TTX-sensitive Na+ currents with IC50 value of 1.1 nM1. It causes a hyperpolarizing shift of about 10 mV in the voltage midpoint of steady-state Na+ channel inactivation and significantly decreases the recovery rate from inactivation1.The Haplopelma hainanum tarantula spider venom was recently found to be a source of various toxic components with different pharmacological properties2. 192 mature toxin sequences were identified by DNA sequencing technique. Hainantoxin-III was one of the toxins identified2.

Supplier :

Alomone Labs

Target :

TTX-sensitive NaV Na+ channels

Long Description :

A Potent Mammalian TTX-Sensitive Voltage-Gated Na+ Channel Blocker

Short Description :

A Potent Mammalian TTX-Sensitive Voltage-Gated Na+ Channel Blocker

MW :

3608 Da

Synonyms :

µ-TRTX-Hhn2a, HnTx-III, Hainantoxin-3

Modifications :

Disulfide bonds between: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29 Leu33 - C-terminal amidation

Molecular formula :

C154H228N44O45S6

Effective Concentration :

1 - 5 nM

Activity :

Hainantoxin-III blocks TTX-sensitive voltage-gated Na+ channels (IC50 = 1.1 nM)1.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL-NH2

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage