chemical

Huwentoxin-XVI

STH-105

STH-105_0.1 mg

Huwentoxin-XVI

Non Antibodies

Proteins

Electrophysiology

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Selenocosmia huwena (Chinese bird spider) (Haplopelma huwenum)

Synthetic peptide

CACNA1B

Huwentoxin XVI (HWTX-XVI) is a peptide toxin originally isolated from the Chinese bird spider Selenocosmia huwena venom1.Huwentoxin-XVI is a specific blocker of N-type (CaV2.2) Ca2+ channels. It has no effect on voltage-gated T-type Ca2+ channels, K+ channels or Na+ channels.Treatment with this toxin was shown to almost completely block the twitch response of rats in response to low-frequency electrical stimulation and to elicit significant analgesic responses to formalin-induced inflammation pain, In addition it has been shown to have higher reversibility rate than other known Ca2+ channels blockers. These findings suggest that HWTX-XVI could be a novel potential analgesic agent with high potency and low side effects2.

Alomone Labs

N-type Ca2+ channels

A Potent and Reversible Blocker of CaV2.2 Channels

A Potent and Reversible Blocker of CaV2.2 Channels

4437 Da

HWTX-XVI

Disulfide bonds between: Cys1-Cys16, Cys8-Cys21 and Cys15-Cys36

C196H292N50O56S6

1 - 10 µM

Huwentoxin-XVI is a potent and reversible N-type Ca2+ channel blocker1.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

1600543-88-1

Lyophilized

Contact Alomone Labs for technical support and product customization

CIGEGVPCDENDPRCCSGLVCLKPTLHGIWYKSYYCYKK-OH

Yes

12352202

yes

no