product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Huwentoxin-XVI
catalog :
STH-105
more info or order :
product information
cat :
STH-105
SKU :
STH-105_0.1 mg
Product Name :
Huwentoxin-XVI
Group Type :
Non Antibodies
Product Type :
Proteins
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Selenocosmia huwena (Chinese bird spider) (Haplopelma huwenum)
Source :
Synthetic peptide
Gene ID :
CACNA1B
Product Page - Scientific background :
Huwentoxin XVI (HWTX-XVI) is a peptide toxin originally isolated from the Chinese bird spider Selenocosmia huwena venom1.Huwentoxin-XVI is a specific blocker of N-type (CaV2.2) Ca2+ channels. It has no effect on voltage-gated T-type Ca2+ channels, K+ channels or Na+ channels.Treatment with this toxin was shown to almost completely block the twitch response of rats in response to low-frequency electrical stimulation and to elicit significant analgesic responses to formalin-induced inflammation pain, In addition it has been shown to have higher reversibility rate than other known Ca2+ channels blockers. These findings suggest that HWTX-XVI could be a novel potential analgesic agent with high potency and low side effects2.
Supplier :
Alomone Labs
Target :
N-type Ca2+ channels
Long Description :
A Potent and Reversible Blocker of CaV2.2 Channels
Short Description :
A Potent and Reversible Blocker of CaV2.2 Channels
MW :
4437 Da
Synonyms :
HWTX-XVI
Modifications :
Disulfide bonds between: Cys1-Cys16, Cys8-Cys21 and Cys15-Cys36
Molecular formula :
C196H292N50O56S6
Effective Concentration :
1 - 10 µM
Activity :
Huwentoxin-XVI is a potent and reversible N-type Ca2+ channel blocker1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
1600543-88-1
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
CIGEGVPCDENDPRCCSGLVCLKPTLHGIWYKSYYCYKK-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel