product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
m3-Huwentoxin IV
catalog :
STH-102
more info or order :
image
image 1 :

Peptide (C)RSAEGGASDPEDVE corresponding to amino acid residues 421-434 of rat MCT3 (AccessionO70461). Intracellular C-terminus.
product information
cat :
STH-102
SKU :
STH-102_0.1 mg
Product Name :
m3-Huwentoxin IV
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P83303
Accession Number :
https://www.uniprot.org/uniprotkb/P83303/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Cyriopagopus schmidti (Chinese bird spider) (Haplopelma schmidti)
Source :
Synthetic peptide
Gene ID :
SCN9A
Product Page - Scientific background :
Huwentoxin IV is a peptide toxin originally isolated from the venom of the Chinese bird-eating spider Haplopelma schmitdi that acts as a potent and selective NaV1.7 channel blocker displaying an IC50 value of 26 nM1. m3-Huwentoxin IV is a mutated form of the toxin with significant increased potency towards NaV1.7, displaying an IC50 value of 0.4 nM1.There are nine mammalian subtypes of voltage-gated sodium (NaV) channels: NaV1.1-NaV1.9. These channels responsible for propagating action potentials in excitable cells and considered to be important therapeutic targets for a wide variety of pathophysiological conditions such as cardiac arrhythmia, and epilepsy2,3.NaV1.7 channel plays an important role in the human pain signaling pathway and it is an important therapeutic target for the treatment of chronic pain2,3.
Supplier :
Alomone Labs
Target :
NaV1.7 channel
Long Description :
A Potent and Selective NaV1.7 Channel Blocker
Short Description :
A Potent and Selective NaV1.7 Channel Blocker
MW :
3986 Da
Synonyms :
Mutated Huwentoxin-IV, Triple-mutated Huwentoxin-IV, m3-HwTx-IV, m3-Huwentoxin-IV
Modifications :
Disulfide bonds between: Cys2-Cys17, Cys9-Cys24, and Cys16-Cys31 Ile35 - C-terminal amidation
Molecular formula :
C170H271N53O46S6
Effective Concentration :
3 - 100 nM
Activity :
m3-Huwentoxin IV is a mutated form of the Huwentoxin IV with significant increased potency towards NaV1.7, displaying an IC50 value of 0.4 nM1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
GCLGIFKACNPSNDQCCKSSKLVCSRKTRWCKWQI-NH2
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments